Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pezi-q2tfw1

Ophiostoma piceae sterol esterase (EC 3.1.1.13)

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Ophiostoma piceae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Ophiostomatales: N E > Ophiostomataceae: N E > Ophiostoma: N E > Ophiostoma piceae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 4BE4, 4BE9, 4UPD
No kinetic





No Substrate
1 inhbitor:
Pentaethylene-glycol
1 Genbank : AY899847
1 UniProt : Q2TFW1
3 Structure : 4UPD, 4BE9, 4BE4
1 UniProt : Q2TFW1
1 Interpro : Q2TFW1
1 Pfam : Q2TFW1
1 PIRSF : Q2TFW1
1 SUPERFAM : Q2TFW1
Sequence
Graphical view for this peptide sequence: 9pezi-q2tfw1
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MPKRRDQSIEPRTTVNVNYPEGEVVGVSVLGIESFRGVPFAQPPVGNLRL
KPPVRYTENIGTKDTTGIGPSCPQMYLSTGNGELLFQLVGNLINIPLFQT
ATLSSEDCLTLNIQRPAGTTSNSSLPVLFWIFGGGFELGTNQYYDGIDLL
TEGISLGEPFIFVAINYRVGGFGFLGGKEIKADGSSNLGLLDQRIALEWV
ADNIASFGGDPSKVTIWGESAGSISVFDQMALYGGNNKYKGKALFRGGIM
NSGSVVPAAPVDGVKAQAIYDHVVSEAGCAGTSDTLACLRTVDYTKFLTA
VNSVPGIVSYSSIALSYLPRPDGVVLIDSPEEIVKNKQYAAVPMIIGDQE
DEGTLFAVLPNNITSTAKIVQYFQDLYFYNATKEQLTAFVNTYPTDITAG
SPFNTGIFNELYPGFKRLAAILGDMTFTLARRAFLQLCSEVNPDVPSWSY
LASYDYGFPFLGTFHATDILQVFYGVLPNYASGSIQKYYINFVTTGDPNK
GAAVDIQWPQWSAKKNILQIYATKAVIVADNFRAKSYEYLYNNIGIFRI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPKRRDQSIEPRTTVNVNYPEGEVVGVSVLGIESFRGVPFAQPPVGNLRL
KPPVRYTENIGTKDTTGIGPSCPQMYLSTGNGELLFQLVGNLINIPLFQT
ATLSSEDCLTLNIQRPAGTTSNSSLPVLFWIFGGGFELGTNQYYDGIDLL
TEGISLGEPFIFVAINYRVGGFGFLGGKEIKADGSSNLGLLDQRIALEWV
ADNIASFGGDPSKVTIWGESAGSISVFDQMALYGGNNKYKGKALFRGGIM
NSGSVVPAAPVDGVKAQAIYDHVVSEAGCAGTSDTLACLRTVDYTKFLTA
VNSVPGIVSYSSIALSYLPRPDGVVLIDSPEEIVKNKQYAAVPMIIGDQE
DEGTLFAVLPNNITSTAKIVQYFQDLYFYNATKEQLTAFVNTYPTDITAG
SPFNTGIFNELYPGFKRLAAILGDMTFTLARRAFLQLCSEVNPDVPSWSY
LASYDYGFPFLGTFHATDILQVFYGVLPNYASGSIQKYYINFVTTGDPNK
GAAVDIQWPQWSAKKNILQIYATKAVIVADNFRAKSYEYLYNNIGIFRI


References
1 more
    Title: Improvement of the Activity of a Fungal Versatile-Lipase Toward Triglycerides: An in silico Mechanistic Description
    Paya-Tormo L, Rodriguez-Salarichs J, Prieto A, Martinez MJ, Barriuso J
    Ref: Front Bioeng Biotechnol, 7:71, 2019 : PubMed

            

    Title: Study of a sterol esterase secreted by Ophiostoma piceae: sequence, model and biochemical properties
    Calero-Rueda O, Barba V, Rodriguez E, Plou F, Martinez AT, Martinez MJ
    Ref: Biochimica & Biophysica Acta, 1794:1099, 2009 : PubMed

            

    Title: Production, isolation and characterization of a sterol esterase from Ophiostoma piceae
    Calero-Rueda O, Plou FJ, Ballesteros A, Martinez AT, Martinez MJ
    Ref: Biochimica & Biophysica Acta, 1599:28, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer