Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9oryz-a0a0d9xh00

Leersia perrieri. Uncharacterized protein

Relationship
Family|Chlorophyllase_Plant
Block| L
Position in NCBI Life Tree|Leersia perrieri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Leersia: N E > Leersia perrieri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A0D9XH00
1 UniProt : A0A0D9XH00
1 Interpro : A0A0D9XH00
1 Pfam : A0A0D9XH00
1 PIRSF : A0A0D9XH00
1 SUPERFAM : A0A0D9XH00
Sequence
Graphical view for this peptide sequence: 9oryz-a0a0d9xh00
Colored MSA for Chlorophyllase_Plant (raw)
MAASAPVAVETTTIITSVDAKNETPAIMAPSPAAVFQPGKLAVEVIKVDH
ELEPRPPIPILIVSPKDAGTYPVAILLHGFFLQNSFYKGLLTHLASHGFI
MVAPQFHLNLISTSDTDDIAAAANVVAWLPAALPTVLPAGVEPDLTKLAL
SGHSRGGHTAFALALGHAQGAGGDKNLPFSALVGLDPVAGKSKSWQLPPK
ILTFEDSSMEFAGGGMPVMVIGTGLGEEAKNFFCPPCAPRDVSHEEFYRE
CRAPCYHVVAKEYGHLDMLDDDAPALVTCLCKDGGCKEKMRRTVGGVMVA
FFRAALNGEDADLVAIVKDHSAASGIAPITLDPVECRLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAASAPVAVETTTIITSVDAKNETPAIMAPSPAAVFQPGKLAVEVIKVDH
ELEPRPPIPILIVSPKDAGTYPVAILLHGFFLQNSFYKGLLTHLASHGFI
MVAPQFHLNLISTSDTDDIAAAANVVAWLPAALPTVLPAGVEPDLTKLAL
SGHSRGGHTAFALALGHAQGAGGDKNLPFSALVGLDPVAGKSKSWQLPPK
ILTFEDSSMEFAGGGMPVMVIGTGLGEEAKNFFCPPCAPRDVSHEEFYRE
CRAPCYHVVAKEYGHLDMLDDDAPALVTCLCKDGGCKEKMRRTVGGVMVA
FFRAALNGEDADLVAIVKDHSAASGIAPITLDPVECRLA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer