Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9lami-a0a2z7c6k4

Dorcoceras hygrometricum. Uncharacterized protein

Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Dorcoceras hygrometricum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Gesneriaceae: N E > Didymocarpoideae: N E > Trichosporeae: N E > Loxocarpinae: N E > Dorcoceras: N E > Dorcoceras hygrometricum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KQ999306
1 UniProt : A0A2Z7C6K4
1 UniProt : A0A2Z7C6K4
1 Interpro : A0A2Z7C6K4
1 Pfam : A0A2Z7C6K4
1 PIRSF : A0A2Z7C6K4
1 SUPERFAM : A0A2Z7C6K4
Sequence
Graphical view for this peptide sequence: 9lami-a0a2z7c6k4
Colored MSA for UCP031088 (raw)
MRILSNMSITQSNINPVIYVAAAALRRDHLLRFDFLRRHRILFSRSPASR
HLVADNFRSRAFSTDKTEPHIGADAAAKKLPDKPSICTADELHYVSIDNS
GWSLALWRYNPSPEAPPRKHPLLLLSGVGTNAIGYDLSHGSSFARYMCGQ
GFDTWILEVRGAGLSMQKTGLKDVKKSADEISERMETAVENATNEVLPVE
QQNSLEKSDVAVFNTEPPGTATAVEESRLVVELTETFMRLSERLSGFLSE
TQSNIMFAKLFDQISKLLEDSSIFERFIEIRGKFSNLLETRQNSGIASQI
RDLSQRLVDVVEEGQRSLSPQLFDLQERVTTTVDDFQKQLDLIVKYDWDF
DHYLEEDVPSAMEYIRSQCKPEDGRILAIGHSMGGILLYALLSRYSSQGR
DPGLAAVVTLGSSLDYTSSKSALKLLTPLADPAQALNVPIVPLGALLSAA
YPLSSRPPYVFSWLNDLISAQDMMHPDLLKKLVLNNFCTIPAKLLLQLTT
AFREGGLRDRSGKFFYKDHLHESKVPVLALAGDHDLICPPEAVHETVKLF
PDHLVTYKVFGEPEGPHYAHYDLVGGLLAAKQLYPCIIEFLIRHDSVQEY
EA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRILSNMSITQSNINPVIYVAAAALRRDHLLRFDFLRRHRILFSRSPASR
HLVADNFRSRAFSTDKTEPHIGADAAAKKLPDKPSICTADELHYVSIDNS
GWSLALWRYNPSPEAPPRKHPLLLLSGVGTNAIGYDLSHGSSFARYMCGQ
GFDTWILEVRGAGLSMQKTGLKDVKKSADEISERMETAVENATNEVLPVE
QQNSLEKSDVAVFNTEPPGTATAVEESRLVVELTETFMRLSERLSGFLSE
TQSNIMFAKLFDQISKLLEDSSIFERFIEIRGKFSNLLETRQNSGIASQI
RDLSQRLVDVVEEGQRSLSPQLFDLQERVTTTVDDFQKQLDLIVKYDWDF
DHYLEEDVPSAMEYIRSQCKPEDGRILAIGHSMGGILLYALLSRYSSQGR
DPGLAAVVTLGSSLDYTSSKSALKLLTPLADPAQALNVPIVPLGALLSAA
YPLSSRPPYVFSWLNDLISAQDMMHPDLLKKLVLNNFCTIPAKLLLQLTT
AFREGGLRDRSGKFFYKDHLHESKVPVLALAGDHDLICPPEAVHETVKLF
PDHLVTYKVFGEPEGPHYAHYDLVGGLLAAKQLYPCIIEFLIRHDSVQEY
EA


Reference
    Title: The resurrection genome of Boea hygrometrica: A blueprint for survival of dehydration
    Xiao L, Yang G, Zhang L, Yang X, Zhao S, Ji Z, Zhou Q, Hu M, Wang Y and He Y <14 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 112:5833, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer