Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9laco-a0a0r2nrk2

Lactobacillus fabifermentans. Tannase

Comment
Other strains: Lactobacillus fabifermentans (DSM 21115; T30PCM01)


Relationship
Family|Tannase_Bact
Block| H
Position in NCBI Life Tree|Lactobacillus fabifermentans DSM 21115
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus fabifermentans: N E > Lactobacillus fabifermentans DSM 21115: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AYGX02000046, AWWK01000066
2 UniProt : A0A0R2NRK2, W6T5V7
2 UniProt : A0A0R2NRK2, W6T5V7
2 Interpro : A0A0R2NRK2, W6T5V7
2 Pfam : A0A0R2NRK2, W6T5V7
2 PIRSF : A0A0R2NRK2, W6T5V7
2 SUPERFAM : A0A0R2NRK2, W6T5V7
Sequence
Graphical view for this peptide sequence: 9laco-a0a0r2nrk2
Colored MSA for Tannase_Bact (raw)
MTQLEFDTAQFQPQLVTLDGQTVRYQAACDIPYVAQPVDDIQQLNIFVPA
AYFEGGTLNGYTAATAPIFMPNTVGGYMPGPRDYPGNQQQPTNSKTLIQA
LRRGYVVVSAGLRGWSQQNAAGDFIGKAPAFIVDMKAAIRYVKANQGRFP
GNTDRIITNGTSAGGATSALVGASGNAKFFEPALAKLGAAQATDDIFAVS
AYCPIHNLEHADMAYEWEFNGINDWHRYKMDFSGAQPKFTPWAGTLTAAQ
QAQSAVLKAQFATYLNSLQLTDTAGAQLTLDADGNGSFRELVRQTVMASA
QTALDQGVDIHKYAGFEVNAGRVTDLDLTAYFVSITRMKAVPAFDELDLS
SPETKLFGDAQTPAKHFTTFASEHSTVPAKLASYELVTNVNPVTYLLHDQ
STRAKHWRVRHGAADRDTSFAIPLILVTLLQNRGLDVDFTLPWDTPHSGD
YDLGELFTWIDQLCQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTQLEFDTAQFQPQLVTLDGQTVRYQAACDIPYVAQPVDDIQQLNIFVPA
AYFEGGTLNGYTAATAPIFMPNTVGGYMPGPRDYPGNQQQPTNSKTLIQA
LRRGYVVVSAGLRGWSQQNAAGDFIGKAPAFIVDMKAAIRYVKANQGRFP
GNTDRIITNGTSAGGATSALVGASGNAKFFEPALAKLGAAQATDDIFAVS
AYCPIHNLEHADMAYEWEFNGINDWHRYKMDFSGAQPKFTPWAGTLTAAQ
QAQSAVLKAQFATYLNSLQLTDTAGAQLTLDADGNGSFRELVRQTVMASA
QTALDQGVDIHKYAGFEVNAGRVTDLDLTAYFVSITRMKAVPAFDELDLS
SPETKLFGDAQTPAKHFTTFASEHSTVPAKLASYELVTNVNPVTYLLHDQ
STRAKHWRVRHGAADRDTSFAIPLILVTLLQNRGLDVDFTLPWDTPHSGD
YDLGELFTWIDQLCQP


References
    Title: Expanding the biotechnology potential of lactobacilli through comparative genomics of 213 strains and associated genera
    Sun Z, Harris HM, McCann A, Guo C, Argimon S, Zhang W, Yang X, Jeffery IB, Cooney JC and O'Toole PW <21 more author(s)>
    Ref: Nat Commun, 6:8322, 2015 : PubMed

            

    Title: Genome Sequence of Lactobacillus fabifermentans Strain T30PCM01, Isolated from Fermenting Grape Marc
    Treu L, Vendramin V, Bovo B, Giacomini A, Corich V, Campanaro S
    Ref: Genome Announc, 2:, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer