Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9laco-a0a0r2jwg5

Lactobacillus lindneri DSM 20690 = JCM 11027. Uncharacterized protein

Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Lactobacillus lindneri DSM 20690 = JCM 11027
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus lindneri: N E > Lactobacillus lindneri DSM 20690 = JCM 11027: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JQBT01000033, WP_054646074
1 UniProt : A0A0R2JWG5
1 UniProt : A0A0R2JWG5
1 Interpro : A0A0R2JWG5
1 Pfam : A0A0R2JWG5
1 PIRSF : A0A0R2JWG5
1 SUPERFAM : A0A0R2JWG5
Sequence
Graphical view for this peptide sequence: 9laco-a0a0r2jwg5
Colored MSA for Asp2 (raw)
MAKPKIITPVIQFGDRDWTTYSDYLSDDFQYYQSDQPDLHQQFVANKPLF
KTNGKLNSAYRNAVFILDEGFPWFEDLDILKKLPANELLVNSAVKLSDES
KHILELKGAFFFDADTKPQQMMSDIQHYFYYDPDGYRLDARGWHINKKSV
KSISQRGEVYRELELKPSDDWKLLMTPNNSTYIPEKMGDKISLDYQEGEQ
SSIGMKITKIDAKTHELIQSVFLQGKQLQKSFAISSDERSTFFQILIYGK
GQGTVKVGDLHVRRSRGPYGEMMPNDQVISDENLHGNVGIYFDAGDLKPP
LNVYFAGYRTKEGYEGRRMMQNFGAPFLLISDWRLEGGAFYLGDDAFEKQ
IIQVIKDTLKKLHFKDNDLILSGMSMGTFGALYYGAKLNPSGIVVGKPLA
EIGTIAQNGRVKRPNDFRTSEDIQLYFENDLSENSSQKLDYRFWSNLENG
SLSQTTLAIAYMFQDDYNRDAYQGIRKRFEILNPTGKLLAKGFEGRHNDQ
TGQVVAWFQRHYWHLLEQYGRKRPPKKKKRKKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKPKIITPVIQFGDRDWTTYSDYLSDDFQYYQSDQPDLHQQFVANKPLF
KTNGKLNSAYRNAVFILDEGFPWFEDLDILKKLPANELLVNSAVKLSDES
KHILELKGAFFFDADTKPQQMMSDIQHYFYYDPDGYRLDARGWHINKKSV
KSISQRGEVYRELELKPSDDWKLLMTPNNSTYIPEKMGDKISLDYQEGEQ
SSIGMKITKIDAKTHELIQSVFLQGKQLQKSFAISSDERSTFFQILIYGK
GQGTVKVGDLHVRRSRGPYGEMMPNDQVISDENLHGNVGIYFDAGDLKPP
LNVYFAGYRTKEGYEGRRMMQNFGAPFLLISDWRLEGGAFYLGDDAFEKQ
IIQVIKDTLKKLHFKDNDLILSGMSMGTFGALYYGAKLNPSGIVVGKPLA
EIGTIAQNGRVKRPNDFRTSEDIQLYFENDLSENSSQKLDYRFWSNLENG
SLSQTTLAIAYMFQDDYNRDAYQGIRKRFEILNPTGKLLAKGFEGRHNDQ
TGQVVAWFQRHYWHLLEQYGRKRPPKKKKRKKK


Reference
    Title: Expanding the biotechnology potential of lactobacilli through comparative genomics of 213 strains and associated genera
    Sun Z, Harris HM, McCann A, Guo C, Argimon S, Zhang W, Yang X, Jeffery IB, Cooney JC and O'Toole PW <21 more author(s)>
    Ref: Nat Commun, 6:8322, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer