Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9homo-a0a0d7bv80

Cylindrobasidium torrendii FP15055 ss-10. Carboxylic ester hydrolase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Cylindrobasidium torrendii FP15055 ss-10
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Physalacriaceae: N E > Cylindrobasidium: N E > Cylindrobasidium torrendii: N E > Cylindrobasidium torrendii FP15055 ss-10: N E > Agaricomycetes incertae sedis: N E > Corticiales: N E > Corticiaceae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KN880431
1 UniProt : A0A0D7BV80
1 UniProt : A0A0D7BV80
1 Interpro : A0A0D7BV80
1 Pfam : A0A0D7BV80
1 PIRSF : A0A0D7BV80
1 SUPERFAM : A0A0D7BV80
Sequence
Graphical view for this peptide sequence: 9homo-a0a0d7bv80
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MLTIYLLVVSLFGGVALSTSDGTVCYTPARPISLDYGTFVGSYNDSSGII
AYRGVPYADPPVGDLRWREPVTPPTSQLGTVNAFEFGPQCIATKRANASI
PITQSEDCLHGNIYVPSWTNATNLPVLVYYHGGGFQSGSSRTAPPEWLMA
SSKMPFIFVTFNYRLGQFGFLGGAALGADGVANAGLFDQRASLKWVQRYI
SSFGGDPSRVTIWGQSAGSAMVMLQLIANGGDNEGLFSQAMGDSPALSSM
PRYNDTVPDEVFRRFASLAGCEVLSPSANTDLMPCLRNASVEALIYAGNA
TAIAYSGLTIFRFTPLVDGKLIIERPVEAFRSGNFVKVPMFFGSNTHEGK
GWAERLTDPIGNTTRTGADAYTVYSFINGQYGGFTTSTFLNATALYPPVS
KGGVNSSYNLLAQEMYGDMRFICTAGLITGSAAQHNITSYQYHYDNPWLG
DMHHYELQAMFSTEETDTYQRMEDTSLFEDMRLYWTSFATQGKPLGSDTR
NVNWLPSQDVSGGPRLLLNPTRVMMEDIDAESLGRRCTMWHNQHEELST
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLTIYLLVVSLFGGVALSTSDGTVCYTPARPISLDYGTFVGSYNDSSGII
AYRGVPYADPPVGDLRWREPVTPPTSQLGTVNAFEFGPQCIATKRANASI
PITQSEDCLHGNIYVPSWTNATNLPVLVYYHGGGFQSGSSRTAPPEWLMA
SSKMPFIFVTFNYRLGQFGFLGGAALGADGVANAGLFDQRASLKWVQRYI
SSFGGDPSRVTIWGQSAGSAMVMLQLIANGGDNEGLFSQAMGDSPALSSM
PRYNDTVPDEVFRRFASLAGCEVLSPSANTDLMPCLRNASVEALIYAGNA
TAIAYSGLTIFRFTPLVDGKLIIERPVEAFRSGNFVKVPMFFGSNTHEGK
GWAERLTDPIGNTTRTGADAYTVYSFINGQYGGFTTSTFLNATALYPPVS
KGGVNSSYNLLAQEMYGDMRFICTAGLITGSAAQHNITSYQYHYDNPWLG
DMHHYELQAMFSTEETDTYQRMEDTSLFEDMRLYWTSFATQGKPLGSDTR
NVNWLPSQDVSGGPRLLLNPTRVMMEDIDAESLGRRCTMWHNQHEELST


Reference
    Title: Evolution of novel wood decay mechanisms in Agaricales revealed by the genome sequences of Fistulina hepatica and Cylindrobasidium torrendii
    Floudas D, Held BW, Riley R, Nagy LG, Koehler G, Ransdell AS, Younus H, Chow J, Chiniquy J and Hibbett DS <10 more author(s)>
    Ref: Fungal Genet Biol, 76:78, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer