Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9homo-a0a0c9w941

Hydnomerulius pinastri MD-312 Unplaced genomic scaffold scaffold_48, whole genome shotgun sequence

Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|Hydnomerulius pinastri MD-312
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Boletales: N E > Paxilineae: N E > Paxillaceae: N E > Hydnomerulius: N E > Hydnomerulius pinastri: N E > Hydnomerulius pinastri MD-312: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A0C9W941
1 Interpro : A0A0C9W941
1 Pfam : A0A0C9W941
1 PIRSF : A0A0C9W941
1 SUPERFAM : A0A0C9W941
Sequence
Graphical view for this peptide sequence: 9homo-a0a0c9w941
Colored MSA for Glucuronoyl_esterase (raw)
MTPSPACSAVPQTISGYNDNALPDPFTFANGSKVTTAAEWECRRNEIISF
IQAYEAGVLPPRPPQLSGSFSNNALTVTAGGVGSSSNTINWTSTITYPTG
TAPSNGWPLLIGYDGGSIPVPSGVALLTFNTETMAQQDSTASRGLGLFYN
LYGANASASALTAWTWGVSRIIDVLEVTPAAKIDTTKIAITGCSRDGKGA
LTTGAFEPRIALTIAQESGSGGAACWRLSLYEQEEGSVVQTATEIVTENV
WFSTTFNNYVNNLSVLPFDHHLLAALIAPRGLLALDNTDFVWLSPVSNYG
CMSAARSVYEALGVEDNMGFMQQGGHAHCAFPSNQTTFLDAFFDKFLLGQ
TGANTDVFLTNNVWNGVTWVASNWTNWATPTLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPSPACSAVPQTISGYNDNALPDPFTFANGSKVTTAAEWECRRNEIISF
IQAYEAGVLPPRPPQLSGSFSNNALTVTAGGVGSSSNTINWTSTITYPTG
TAPSNGWPLLIGYDGGSIPVPSGVALLTFNTETMAQQDSTASRGLGLFYN
LYGANASASALTAWTWGVSRIIDVLEVTPAAKIDTTKIAITGCSRDGKGA
LTTGAFEPRIALTIAQESGSGGAACWRLSLYEQEEGSVVQTATEIVTENV
WFSTTFNNYVNNLSVLPFDHHLLAALIAPRGLLALDNTDFVWLSPVSNYG
CMSAARSVYEALGVEDNMGFMQQGGHAHCAFPSNQTTFLDAFFDKFLLGQ
TGANTDVFLTNNVWNGVTWVASNWTNWATPTLS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer