Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-q4a538

Vibrio salmonicida Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) luxd

Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Vibrio salmonicida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Aliivibrio: N E > Aliivibrio salmonicida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF452135, FM178380
2 UniProt : Q4A538, B6ESM6
2 UniProt : Q4A538, B6ESM6
2 Interpro : Q4A538, B6ESM6
2 Pfam : Q4A538, B6ESM6
2 PIRSF : Q4A538, B6ESM6
2 SUPERFAM : Q4A538, B6ESM6
Sequence
Graphical view for this peptide sequence: 9gamm-q4a538
Colored MSA for Thioesterase_acyl-transferase (raw)
MDHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGDINEFSMSIGKDSLLTVI
DWLKGRNIEKLGLIAASLSARIAYEIANEIDLSFLVTAVGVVNLRDTLER
ALKYDYLQLPIEKLPEDLDFEGHNLGSEVFVTDCFKHKWDTLDSTINKMK
NLDVPFIAFTANDDNWVKQSEVLDLLISLNSEKCKLYSLIGSSHDLGENL
VVLRNFYQSVTKAAIALDNDSLDLDVNMTEPRFEDITSVTVKERRLKNQI
ENESLELV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGDINEFSMSIGKDSLLTVI
DWLKGRNIEKLGLIAASLSARIAYEIANEIDLSFLVTAVGVVNLRDTLER
ALKYDYLQLPIEKLPEDLDFEGHNLGSEVFVTDCFKHKWDTLDSTINKMK
NLDVPFIAFTANDDNWVKQSEVLDLLISLNSEKCKLYSLIGSSHDLGENL
VVLRNFYQSVTKAAIALDNDSLDLDVNMTEPRFEDITSVTVKERRLKNQI
ENESLELV


Reference
    Title: Complete genome sequence of the oral pathogenic Bacterium porphyromonas gingivalis strain W83
    Nelson KE, Fleischmann RD, DeBoy RT, Paulsen IT, Fouts DE, Eisen JA, Daugherty SC, Dodson RJ, Durkin AS and Fraser CM <13 more author(s)>
    Ref: Journal of Bacteriology, 185:5591, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer