Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-d7gqv1

butyrate-producing bacterium SS3/4 Putative uncharacterized protein

Relationship
Family|Tannase_Bact
Block| H
Position in NCBI Life Tree|butyrate-producing bacterium SS3/4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > unclassified Clostridiales: N E > unclassified Clostridiales (miscellaneous): N E > butyrate-producing bacterium SS3/4: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FP929062, CBL40176
1 UniProt : D7GQV1
1 UniProt : D7GQV1
1 Interpro : D7GQV1
1 Pfam : D7GQV1
1 PIRSF : D7GQV1
1 SUPERFAM : D7GQV1
Sequence
Graphical view for this peptide sequence: 9firm-d7gqv1
Colored MSA for Tannase_Bact (raw)
MMKVGRRIGLFLAAALILSGCSNSAAEIGSSAAQTEAETSQAETERAGET
AVTSLPQIDSTKWQYNSDDKIYWQTGISYCENPADENYETLGIFIPAAYM
NAKDNGDGTFTCEINNQAAVQGYTADSAPIVIPVNTPGYSAMEAPTDYVT
DSVSYTSAGFIYVAAGCRGRDAGAPAGVTDLKAAIRYIRYNDGVIPGDVD
RIFSFGMSGGGAQSALLGATGDSEDYEPYLTAIGAVSGVSDAVTGSMCWC
PITELDYADEAYEWNLGSTRTDLTEQEQTLSNGMAEAFAQYINDLGLKDS
SGNVLTLTESEEGIYQSGTYYEYLKGVVETSLNNFLEDTTFPYKVETKKG
PRGGGERPDGQKPDGAPQGENSGQKPDGAPQDGNGMPDDMQKDGQKDGRL
DGKQAQGTSDENKAGDDTTKTRTEKNRKASEEKAPADKNADGDTASDKGN
GAPDFYAMDGVDRNLSTGGVTLSGTYETAQDYIDALNADGTWVNYDSATN
TATITSIADFTNACKRASKGIGAFDALDESQAENTLFGYGDGTTSHFDAI
LADLLKDDETYGAAFTEAMEKTDSQGNTVTERGNMYNPLYYLSSYYDGYQ
KSTVADYWRIRTGIAQSDTSLTTEVNLALALKNYGADVDFATIWGEGHTM
AESTGDSVTNFIEWVNKCLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKVGRRIGLFLAAALILSGCSNSAAEIGSSAAQTEAETSQAETERAGET
AVTSLPQIDSTKWQYNSDDKIYWQTGISYCENPADENYETLGIFIPAAYM
NAKDNGDGTFTCEINNQAAVQGYTADSAPIVIPVNTPGYSAMEAPTDYVT
DSVSYTSAGFIYVAAGCRGRDAGAPAGVTDLKAAIRYIRYNDGVIPGDVD
RIFSFGMSGGGAQSALLGATGDSEDYEPYLTAIGAVSGVSDAVTGSMCWC
PITELDYADEAYEWNLGSTRTDLTEQEQTLSNGMAEAFAQYINDLGLKDS
SGNVLTLTESEEGIYQSGTYYEYLKGVVETSLNNFLEDTTFPYKVETKKG
PRGGGERPDGQKPDGAPQGENSGQKPDGAPQDGNGMPDDMQKDGQKDGRL
DGKQAQGTSDENKAGDDTTKTRTEKNRKASEEKAPADKNADGDTASDKGN
GAPDFYAMDGVDRNLSTGGVTLSGTYETAQDYIDALNADGTWVNYDSATN
TATITSIADFTNACKRASKGIGAFDALDESQAENTLFGYGDGTTSHFDAI
LADLLKDDETYGAAFTEAMEKTDSQGNTVTERGNMYNPLYYLSSYYDGYQ
KSTVADYWRIRTGIAQSDTSLTTEVNLALALKNYGADVDFATIWGEGHTM
AESTGDSVTNFIEWVNKCLK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer