Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9euro-a0a0d1xir3

Exophiala mesophila. Carboxylic ester hydrolase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Exophiala mesophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Chaetothyriomycetidae: N E > Chaetothyriales: N E > Herpotrichiellaceae: N E > Exophiala: N E > Exophiala mesophila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KN847527
1 UniProt : A0A0D1XIR3
1 UniProt : A0A0D1XIR3
1 Interpro : A0A0D1XIR3
1 Pfam : A0A0D1XIR3
1 PIRSF : A0A0D1XIR3
1 SUPERFAM : A0A0D1XIR3
Sequence
Graphical view for this peptide sequence: 9euro-a0a0d1xir3
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MRINITRLFLAAVIFGQQIPFAVAFATPRHLPVVDLEYAVHQATLSETGN
YYNFSNIRYGDVIDASTRFQPPRPPQTQNRTLNTGQIATRCPQTHPFWLV
DGSAIAEGIPADQLEPVQFNISQIPPKNPEETEDCLFLDVMVPTKTFPSP
GPHKQRPNHTETGAPVLVWIDGGGFSAGYKHEQPPAGLVSRSQLVDDKGF
IFVAMNYRVGLFGFLPAAIVGQGHSNVGLLDQRLALDWVQKYIHLFGGDP
SRVTIMGESAGGGSVLHQITAYGGSEPVPFQQAILQSPGFQPNGNPGFQE
QLIDYALTNASVLTNKTVETVDDLRSLSFDEITLLNSVIVGRSPYGTYTF
GPVVDGSLVPELPGTLIGQGRFATSLKGLLMGTNFNEGVLFDSPFLKNDS
DYRGNVQLFFPKATDEVVDYVATVLYPDDLSGKYNYTTQPLRAAITTAEG
CFLCNTRYLANALPNIVSTRIYKYLFAVPPAIHADDLGYSFYNGNGSLTW
EGFPVKEKTALTLQDYIASFTITGSPNDGSAADFHPVFPAYGDDALVLIL
NETNLGEIIIDAQANSRCDWWQKGLFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRINITRLFLAAVIFGQQIPFAVAFATPRHLPVVDLEYAVHQATLSETGN
YYNFSNIRYGDVIDASTRFQPPRPPQTQNRTLNTGQIATRCPQTHPFWLV
DGSAIAEGIPADQLEPVQFNISQIPPKNPEETEDCLFLDVMVPTKTFPSP
GPHKQRPNHTETGAPVLVWIDGGGFSAGYKHEQPPAGLVSRSQLVDDKGF
IFVAMNYRVGLFGFLPAAIVGQGHSNVGLLDQRLALDWVQKYIHLFGGDP
SRVTIMGESAGGGSVLHQITAYGGSEPVPFQQAILQSPGFQPNGNPGFQE
QLIDYALTNASVLTNKTVETVDDLRSLSFDEITLLNSVIVGRSPYGTYTF
GPVVDGSLVPELPGTLIGQGRFATSLKGLLMGTNFNEGVLFDSPFLKNDS
DYRGNVQLFFPKATDEVVDYVATVLYPDDLSGKYNYTTQPLRAAITTAEG
CFLCNTRYLANALPNIVSTRIYKYLFAVPPAIHADDLGYSFYNGNGSLTW
EGFPVKEKTALTLQDYIASFTITGSPNDGSAADFHPVFPAYGDDALVLIL
NETNLGEIIIDAQANSRCDWWQKGLFV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer