Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9delt-a6gcp2

Plesiocystis pacifica SIR-1 Putative uncharacterized protein

Comment
only c-term Pfam A Abhydrolase_6 562 851


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Plesiocystis pacifica SIR-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Myxococcales: N E > Nannocystineae: N E > Nannocystaceae: N E > Plesiocystis: N E > Plesiocystis pacifica: N E > Plesiocystis pacifica SIR-1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABCS01000066
1 UniProt : A6GCP2
1 UniProt : A6GCP2
1 Interpro : A6GCP2
1 Pfam : A6GCP2
1 PIRSF : A6GCP2
1 SUPERFAM : A6GCP2
Sequence
Graphical view for this peptide sequence: 9delt-a6gcp2
Colored MSA for 6_AlphaBeta_hydrolase (raw)
HGLGVSSGIFTVDTIGTNLVEYLFAHGYDLWLLDFRASIELASAEVPASC
DLMATVDLPEGIAEVRRLSGADSVQVIAHCIGATLFYMSALAGKLEGVRA
ALTSQATPHIDGSRDHRIKSGLRLPAVLESLGFTSLTAYTDKHDGWLDRL
YDRALELYPVAREEERGASATARRITFLYSQLYEHDQLNVATHDTLHELF
GVANLSCFDQLGAIIRAEHIVDAEGGDVYLPQVGRLALPLRMIHGAENAC
YLPSGSERSYAWLRQHNDPALYSRVVIPDYGHIDCIFGKDAAEHVYPHIL
EHLEANL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HGLGVSSGIFTVDTIGTNLVEYLFAHGYDLWLLDFRASIELASAEVPASC
DLMATVDLPEGIAEVRRLSGADSVQVIAHCIGATLFYMSALAGKLEGVRA
ALTSQATPHIDGSRDHRIKSGLRLPAVLESLGFTSLTAYTDKHDGWLDRL
YDRALELYPVAREEERGASATARRITFLYSQLYEHDQLNVATHDTLHELF
GVANLSCFDQLGAIIRAEHIVDAEGGDVYLPQVGRLALPLRMIHGAENAC
YLPSGSERSYAWLRQHNDPALYSRVVIPDYGHIDCIFGKDAAEHVYPHIL
EHLEANL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer