Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-c9y8q9

Curvibacter putative symbiont of Hydra magnipapillata Putative uncharacterized protein

Comment
only c-term Pfam A Abhydrolase_6 277 577


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Curvibacter putative symbiont of Hydra magnipapillata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Curvibacter: N E > Curvibacter putative symbiont of Hydra magnipapillata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FN543104
1 UniProt : C9Y8Q9
1 UniProt : C9Y8Q9
1 Interpro : C9Y8Q9
1 Pfam : C9Y8Q9
1 PIRSF : C9Y8Q9
1 SUPERFAM : C9Y8Q9
Sequence
Graphical view for this peptide sequence: 9burk-c9y8q9
Colored MSA for 6_AlphaBeta_hydrolase (raw)
TGDGLGISLLRFQRAPCKDVVLLVPGLTASSDMFIMPEHRNLTQVLLDEG
FTDVWTLDGRISKRQPYNHTRHRFTVDDVALYDNPAALDVVRRAVGPEAR
IHIISHCLGALSVAMSLFGKAIQGVRSVIVNGVALTPKVGTFAKAKLAVG
PFLAESVLGVDYLNPEWNQQAGISPGKLLAKGVSFMHRECDVPECHMTSF
MWGYGYPVLFRHENLHEITHRRTGDLFGGSGVHYYRHIRKMVGADNSAVK
FDPKDVRYRHLPDNYLQDAADITTPMLLVAGQENALFLDSNVLCHERLEQ
VAPGRHQLAVIPGYGHADVIIGKNAAQDVFPRFVEFLKQNAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

TGDGLGISLLRFQRAPCKDVVLLVPGLTASSDMFIMPEHRNLTQVLLDEG
FTDVWTLDGRISKRQPYNHTRHRFTVDDVALYDNPAALDVVRRAVGPEAR
IHIISHCLGALSVAMSLFGKAIQGVRSVIVNGVALTPKVGTFAKAKLAVG
PFLAESVLGVDYLNPEWNQQAGISPGKLLAKGVSFMHRECDVPECHMTSF
MWGYGYPVLFRHENLHEITHRRTGDLFGGSGVHYYRHIRKMVGADNSAVK
FDPKDVRYRHLPDNYLQDAADITTPMLLVAGQENALFLDSNVLCHERLEQ
VAPGRHQLAVIPGYGHADVIIGKNAAQDVFPRFVEFLKQNAH


Reference
    Title: The dynamic genome of Hydra
    Chapman JA, Kirkness EF, Simakov O, Hampson SE, Mitros T, Weinmaier T, Rattei T, Balasubramanian PG, Borman J and Steele RE <64 more author(s)>
    Ref: Nature, 464:592, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer