Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9brad-i0gfv2

Bradyrhizobium sp. S23321. Uncharacterized protein

Comment
only n-term Pfam A DUF2235 35 325


Relationship
Family|T6SS-TLE1
Block| X
Position in NCBI Life Tree|Bradyrhizobium sp. S23321
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium sp. S23321: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP012279
Sequence
Graphical view for this peptide sequence: 9brad-i0gfv2
Colored MSA for T6SS-TLE1 (raw)
MTHQDDALRGGPVKPDHTHDDPGTAANAPDARAPRKLVLFADGTGNAFTT
QESSVWRLYEALDHTQPDQIAYYIKGVGTAGWAPLAALDGATGIGVPSNV
RKLYRFLCWNWRPGDEIYIFGFSRGAFTARTLASMIASQGLVPAEIKGEP
VSHAEMERNAMAAWREYRRGTVPLKKSLPTIWIARLIRDVLLYVYHLICR
HRSYADVRAAMRGREEIDIEFLGLFDTVEAYGVPIEELRVAIDWAIWPIS
FRNHRPSRKVKHIRHALALDDERTTFHPLRIDQSHLAADQTVKEVWFAGV
HSDIGGGYPESTLSFVPLVWMTDQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTHQDDALRGGPVKPDHTHDDPGTAANAPDARAPRKLVLFADGTGNAFTT
QESSVWRLYEALDHTQPDQIAYYIKGVGTAGWAPLAALDGATGIGVPSNV
RKLYRFLCWNWRPGDEIYIFGFSRGAFTARTLASMIASQGLVPAEIKGEP
VSHAEMERNAMAAWREYRRGTVPLKKSLPTIWIARLIRDVLLYVYHLICR
HRSYADVRAAMRGREEIDIEFLGLFDTVEAYGVPIEELRVAIDWAIWPIS
FRNHRPSRKVKHIRHALALDDERTTFHPLRIDQSHLAADQTVKEVWFAGV
HSDIGGGYPESTLSFVPLVWMTDQL


Reference
    Title: Complete genome sequence of Bradyrhizobium sp. S23321: insights into symbiosis evolution in soil oligotrophs
    Okubo T, Tsukui T, Maita H, Okamoto S, Oshima K, Fujisawa T, Saito A, Futamata H, Hattori R and Minamisawa K <38 more author(s)>
    Ref: Microbes Environ, 27:306, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer