Gene_locus Report for: 9brad-a0a0d7p6z6Bradyrhizobium sp. esterase found in n-term of an OsmC/Ohr family domain Comment This esterase is found in n-term of an OsmC/Ohr family domain excluded here Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium sp.: N E
6_AlphaBeta_hydrolase : brasb-a5e8s7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, brasb-a5ech6Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta hydrolase, brasb-a5ees1Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative Hydrolase, alpha/beta hydrolase fold family, brasb-a5eh09Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta-Hydrolases superfamily, brasb-a5elh0Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta hydrolase, brasb-a5ene5Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, brasb-a5ep81Bradyrhizobium sp. (strains BTAi1 / ATCC BAA-1182; ORS278) Putative hydrolase, alpha/beta fold family, brasb-a5eqb3Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta hydrolase fold protein, brasb-a5esv5Bradyrhizobium sp. Putative DNA-binding transcriptional activator of the SARP family /hydrolases or acyltransferases (Alpha/beta hydrolase superfamily), braso-a4yk16Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein, braso-a4yl66Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein, braso-a4ynl1Bradyrhizobium sp. (strain ORS278) Putative alpha/beta hydrolase fold, braso-a4yqh3Bradyrhizobium sp. (strain ORS278) Putative Alpha/beta hydrolase; putative Carboxylesterase/3-oxoadipate enol-lactonase, braso-a4yw76Bradyrhizobium sp. (strain ORS278) Putative enzyme with alpha/beta-hydrolase domain; putative triacylglycerol lipase (Esterase), braso-a4yyj6Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein, braso-a4z0v7Bradyrhizobium sp. (strain ORS278) Putative alpha/beta hydrolase; putative haloalkane dehalogenase, braso-a4z1p1Bradyrhizobium sp. (strain ORS278) (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta-Hydrolases superfamily; putative 3-oxoadipate enol-lactonase. A85-EsteraseD-FGH : brasb-a5eny8Bradyrhizobium sp. (strains BTAi1 / ATCC BAA-1182; ORS278) S-formylglutathione hydrolase. Abhydrolase_9 : 9brad-a0a0d7pdd9Bradyrhizobium sp. Membrane protein, 9brad-a0a0x8cpp1Bradyrhizobium sp. Uncharacterized protein, 9brad-a0a150u9u7Bradyrhizobium sp. Membrane protein, 9brad-a0a150zbn4Bradyrhizobium sp. Membrane protein, 9brad-a0a160v195Bradyrhizobium sp.; Bradyrhizobium japonicum Uncharacterized protein, 9brad-a0a176yuk6Bradyrhizobium sp. Uncharacterized protein, 9brad-a0a1c3u8y2Bradyrhizobium sp. Uncharacterized membrane protein, 9brad-i2qc78Bradyrhizobium sp. Putative membrane protein. Aclacinomycin-methylesterase_RdmC : brasb-a5efp4Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182; ORS278) Putative uncharacterized protein, braso-a4yr10Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein. BD-FAE : 9brad-a0a0q5zcb2Bradyrhizobium sp. Uncharacterized protein. Carboxymethylbutenolide_lactonase : brasb-a5ema7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) (strain ORS278) 3-oxoadipate enol-lactonase, 9brad-h0sxc0Bradyrhizobium sp. 3-oxoadipate enol-lactonase (Enol-lactone hydrolase) (Beta-ketoadipate enol-lactone hydrolase). Carb_B_Bacteria : 9brad-a0a265pr64Bradyrhizobium amphicarpaeae; Bradyrhizobium sp. 2(2017). Esterase, 9brad-a0a265qdb0Bradyrhizobium sp. 3(2017). Esterase, braso-a4yzd7Bradyrhizobium sp. (strains ORS278, STM 3809) putative carboxylesterase, type b (EC 3.1.1.1). CFTR-inhibitory-factor_Cif : brasb-a5edz7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative hydrolase, brasb-a5emc8Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative hydrolase, braso-a4ypd9Bradyrhizobium sp. (strain ORS278) Putative hydrolase, braso-a4z2a5Bradyrhizobium sp. (strain ORS278) Putative hydrolase. Chlorophyllase : brasz-a0a160uhs5Bradyrhizobium sp. Uncharacterized protein, braso-a4yr63Bradyrhizobium sp.. Putative hydrolase. Dienelactone_hydrolase : brasz-naacBradyrhizobium sp. Lactone hydrolase NaaC. Duf_3141 : brasb-a5ef53Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, brasb-a5eg29Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, brasb-a5eul1Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, braso-a4z1h1Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein. Epoxide_hydrolase : brasb-a5eb24Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative hydrolase, alpha/beta fold family, brasb-a5efp3Bradyrhizobium sp. Putative epoxide hydrolase, brasb-a5ej26Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative epoxide hydrolase, braso-a4ylm4Bradyrhizobium sp. (strains ORS278; BTAi1 / ATCC BAA-1182) Putative Hydrolase, alpha/beta fold family, braso-a4ylr9Bradyrhizobium sp. (strains ORS278; BTAi1 / ATCC BAA-1182) Putative epoxide hydrolase, braso-a4yul4Bradyrhizobium sp. (strain ORS278) Epoxide hydrolase, braso-a4yxg2Bradyrhizobium sp. (strain ORS278)(strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, braso-a4z1v6Bradyrhizobium sp. (strain ORS278) Putative hydrolase, alpha/beta fold family. Est-OsmC : 9brad-a0a120fq09Bradyrhizobium sp. esterase found in n-term of an OsmC/Ohr family domain, 9brad-a0a1b9z3k4Bradyrhizobium sp. esterase found in n-term of an OsmC/Ohr family domain, 9brad-h0tcp6Bradyrhizobium sp. esterase found in n-term of an OsmC/Ohr family domain, 9brad-a0a1i3km41Bradyrhizobium sp. esterase found in n-term of an OsmC/Ohr family domain. Haloacetate_dehalogenase : braso-a4z0q9Bradyrhizobium sp. (strain ORS278) Putative hydrolase. Haloperoxidase : brasb-a5ed44Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Non-heme chloroperoxidase, brasb-a5ee62Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Non-heme chloroperoxidase, braso-a4ylx7Bradyrhizobium sp. (strain ORS278) Arylesterase (Aryl-ester hydrolase), braso-a4yri0Bradyrhizobium sp. (strain ORS278) BTAi1 Non-heme chloroperoxidase (Chloride peroxidase) (CPO-P) (Chloroperoxidase P), braso-a4ywb6Bradyrhizobium sp. (strain ORS278) (strain BTAi1 / ATCC BAA-1182) Non-heme chloroperoxidase (Chloride peroxidase) (CPO-P) (Chloroperoxidase P), braso-a4yy49Bradyrhizobium sp. (strains ORS278; BTAi1 / ATCC BAA-1182) Non-heme haloperoxidase. HNLyase_Bact : brasb-a5ei81Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative alpha/beta hydrolase family protein, brasb-a5esw6Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative esterase, braso-a4yt56Bradyrhizobium sp. (strain ORS278) Putative alpha/beta hydrolase family protein. Homoserine_transacetylase : braso-a4z1p8Bradyrhizobium sp. (strain ORS278) (BTAi1 / ATCC BAA-1182)) Homoserine O-acetyltransferase (Homoserine O-trans-acetylase) (Homoserine transacetylase) (HTA). Mg-chelatase_BchO : braso-a4ynl2Bradyrhizobium sp. (strain ORS278). Bradyrhizobium sp. ORS278,complete sequence, brasb-a5eqb2Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182). Putative Alpha/beta hydrolase, putative protoporphyrin IX magnesium chelatase bchO-like protein. Monoglyceridelipase_lysophospholip : brasb-a5eph8Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, braso-a4yzh0Bradyrhizobium sp. (strain ORS278) Putative uncharacterized protein, braso-a4z152Bradyrhizobium sp. (strains ORS278; BTAi1 / ATCC BAA-1182) Putative lysophospholipase L2, (Lecithinase B). NLS3-Tex30 : braso-a4yl32Bradyrhizobium sp. (strain ORS278) Uncharacterized protein, brasb-a5et63Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Uncharacterized protein. Proline_iminopeptidase : brasb-a5epx9Bradyrhizobium sp. (strains BTAi1 / ATCC BAA-1182; ORS278) Proline iminopeptidase, brasb-a5emr8Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182). Putative Prolyl aminopeptidase. UCP031982 : brasb-a5eac3Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative hydrolase, putative exported protein, brasb-a5eiy7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative hydrolase, putative exported protein, brasb-a5eml7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative uncharacterized protein, brasb-a5erc8Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Putative LIPOprotein SIGNAL PEPTIDE, braso-a4ymj8Bradyrhizobium sp. (strain ORS278) Putative LIPOPROTEIN SIGNAL PEPTIDE
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9brad-a0a0d7p6z6
Colored MSA for Est-OsmC (raw)
MPHERFQFTGTGGHQLAAALDTPDGPVKAYALFAHCFTCGKDVLAAKRIA
VALAAKGIATLRFDFTGLGSSEGDFANSTFSSNVADLVRAADHLRETRQA
PAILIGHSLGGAAILAAAGKIPEAKAVVTVSAPSDPAHVTHLFKDKVDDI
RAQGEVEVSLAGRPFRIKRELLDDVAEQNLTAQVTKLHKALLVMHSPTDD
TVGIDNATHIFVAAKHPKSFVSLAGADHLLSGKEDAAYVADVIGAWVERY
V
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MPHERFQFTGTGGHQLAAALDTPDGPVKAYALFAHCFTCGKDVLAAKRIA
VALAAKGIATLRFDFTGLGSSEGDFANSTFSSNVADLVRAADHLRETRQA
PAILIGHSLGGAAILAAAGKIPEAKAVVTVSAPSDPAHVTHLFKDKVDDI
RAQGEVEVSLAGRPFRIKRELLDDVAEQNLTAQVTKLHKALLVMHSPTDD
TVGIDNATHIFVAAKHPKSFVSLAGADHLLSGKEDAAYVADVIGAWVERY
V
|
|
|
|
