Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-d8pbw6

Candidatus Nitrospira defluvii Putative uncharacterized protein

Comment
only central part 362 - 603 Thioesterase_acyl-transferase


Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Candidatus Nitrospira defluvii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Nitrospirae: N E > Nitrospira [class]: N E > Nitrospirales: N E > Nitrospiraceae: N E > Nitrospira [genus]: N E > Nitrospira defluvii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FP929003
1 UniProt : D8PBW6
1 UniProt : D8PBW6
1 Interpro : D8PBW6
1 Pfam : D8PBW6
1 PIRSF : D8PBW6
1 SUPERFAM : D8PBW6
Sequence
Graphical view for this peptide sequence: 9bact-d8pbw6
Colored MSA for Thioesterase_acyl-transferase (raw)
VVLAPGYGESKRDYVPLAYYLAGNGFHVVRFDNVNHVGESDGLVTQFRLE
DMETDLETVLDYVAAQWPGRSIGLVATSLAGRVALKVAGRVPHLGLLALI
NGIMDVQHTLQAVHQEDLIGEHLAGARKGVVNILGLTIDADRWLEHAVQG
GYADLRSTEQDAERLHAPVVLFHAEQDAWVDPSSIEAVGAAMGENLRHSY
VVPGALHRLQESPRKARTVYRQIALCCQEELWPARSMARTVEPSHREIGV
QNRAERERSKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VVLAPGYGESKRDYVPLAYYLAGNGFHVVRFDNVNHVGESDGLVTQFRLE
DMETDLETVLDYVAAQWPGRSIGLVATSLAGRVALKVAGRVPHLGLLALI
NGIMDVQHTLQAVHQEDLIGEHLAGARKGVVNILGLTIDADRWLEHAVQG
GYADLRSTEQDAERLHAPVVLFHAEQDAWVDPSSIEAVGAAMGENLRHSY
VVPGALHRLQESPRKARTVYRQIALCCQEELWPARSMARTVEPSHREIGV
QNRAERERSKK


Reference
    Title: A Nitrospira metagenome illuminates the physiology and evolution of globally important nitrite-oxidizing bacteria
    Lucker S, Wagner M, Maixner F, Pelletier E, Koch H, Vacherie B, Rattei T, Damste JS, Spieck E and Daims H <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:13479, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer