Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-d1n3e0

Victivallis vadensis ATCC BAA-548 Putative uncharacterized protein

Comment
Other strains: Victivallis vadensis ATCC BAA-548


Relationship
Family|BioG_Pimeloyl-ACP-methyl-esterase
Block| X
Position in NCBI Life Tree|Victivallis vadensis ATCC BAA-548
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Lentisphaerae: N E > Lentisphaeria: N E > Victivallales: N E > Victivallaceae: N E > Victivallis: N E > Victivallis vadensis: N E > Victivallis vadensis ATCC BAA-548: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_116882233, PVY45837
1 UniProt : A0A2U1BB93
1 UniProt : A0A2U1BB93
1 Interpro : A0A2U1BB93
1 Pfam : A0A2U1BB93
1 PIRSF : A0A2U1BB93
1 SUPERFAM : A0A2U1BB93
Sequence
Graphical view for this peptide sequence: 9bact-d1n3e0
Colored MSA for BioG_Pimeloyl-ACP-methyl-esterase (raw)
MNAAFIRQNHTPVLELFFNGWSMDDCVAHALAGADDLLAVWDYTSFDLDL
LPLLAGYREIRLTAWSLGVWSAAKYFENKEVAFADAVAVNGTLQPVSAEY
GIAPDIFAGTAANWLEERARERFNLRLAGGRAELAAFPGSGRSAESQQNE
LNSLLHNIMESLIPANLFRLAVIGSRDRIFSPAAQRAAWQMTESRIVEID
SPHYPFALYPEVAELGKLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNAAFIRQNHTPVLELFFNGWSMDDCVAHALAGADDLLAVWDYTSFDLDL
LPLLAGYREIRLTAWSLGVWSAAKYFENKEVAFADAVAVNGTLQPVSAEY
GIAPDIFAGTAANWLEERARERFNLRLAGGRAELAAFPGSGRSAESQQNE
LNSLLHNIMESLIPANLFRLAVIGSRDRIFSPAAQRAAWQMTESRIVEID
SPHYPFALYPEVAELGKLG


Reference
    Title: Genome sequence of Victivallis vadensis ATCC BAA-548, an anaerobic bacterium from the phylum Lentisphaerae, isolated from the human gastrointestinal tract
    van Passel MW, Kant R, Palva A, Lucas S, Copeland A, Lapidus A, Glavina Del Rio T, Dalin E, Tice H and Zoetendal EG <16 more author(s)>
    Ref: Journal of Bacteriology, 193:2373, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer