Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a088s6n7

uncultured bacterium. Esterase Est10

Relationship
Family|Duf_3089
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AIO05654
1 UniProt : A0A088S6N7
1 UniProt : A0A088S6N7
1 Interpro : A0A088S6N7
1 Pfam : A0A088S6N7
1 PIRSF : A0A088S6N7
1 SUPERFAM : A0A088S6N7
Sequence
Graphical view for this peptide sequence: 9bact-a0a088s6n7
Colored MSA for Duf_3089 (raw)
MIMKKQNFFVLLASVMLLAMNLASCKMSNKPAAETSRIGEIPEAAQYIVG
IEKYDSVIDYSKAECWLDVPAAMVKDGVLDATAADSLKAIDRFYIYPTVT
GFRPETEVCDMTDTMMIAGAQMVRRVQTAVFEESCNVFMPYYRQISMPKP
GSDYSAIIDYVSGFDATDALDYFLNNLNQGRPFILAGHSQGAATLIALLE
NYMTKHPEALKRMIAAYPIGFAVTEDWLAKTGLKFAEGATDTGVIVSWNT
EGPANLTEKNMTLAPGGISINPINWKRDDTPASVKENLGSLTYDGKLVTP
GIADARVDTVRGSVVVSTIADKELYVIPADGAAMFGPESYHLHDYGFFFN
NIKQNVADRVKAFLEKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIMKKQNFFVLLASVMLLAMNLASCKMSNKPAAETSRIGEIPEAAQYIVG
IEKYDSVIDYSKAECWLDVPAAMVKDGVLDATAADSLKAIDRFYIYPTVT
GFRPETEVCDMTDTMMIAGAQMVRRVQTAVFEESCNVFMPYYRQISMPKP
GSDYSAIIDYVSGFDATDALDYFLNNLNQGRPFILAGHSQGAATLIALLE
NYMTKHPEALKRMIAAYPIGFAVTEDWLAKTGLKFAEGATDTGVIVSWNT
EGPANLTEKNMTLAPGGISINPINWKRDDTPASVKENLGSLTYDGKLVTP
GIADARVDTVRGSVVVSTIADKELYVIPADGAAMFGPESYHLHDYGFFFN
NIKQNVADRVKAFLEKK


Reference
    Title: Est10: A Novel Alkaline Esterase Isolated from Bovine Rumen Belonging to the New Family XV of Lipolytic Enzymes
    Rodriguez MC, Loaces I, Amarelle V, Senatore D, Iriarte A, Fabiano E, Noya F
    Ref: PLoS ONE, 10:e0126651, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer