Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-EH0

uncultured bacterium ester-hydrolase EH0 from the metagenome of Sorghum bicolor rhizosphere from the Henfaes research centre (Gwynedd Wales)

Comment
Cea-Rama, I., Sanz-Aparicio, J.


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7ZR3: Structure of ester-hydrolase EH0 from the metagenome of sorghum bicolor rhizospher from Henfaes research center (Gwynedd, Wales)
No kinetic





1 substrate:
BHET
No inhibitor
1 UniProt : A0A8E4HNI8
1 Structure : 7ZR3
1 UniProt : A0A8E4HNI8
1 Interpro : A0A8E4HNI8
1 Pfam : A0A8E4HNI8
1 PIRSF : A0A8E4HNI8
1 SUPERFAM : A0A8E4HNI8
Sequence
Graphical view for this peptide sequence: 9bact-EH0
Colored MSA for Hormone-sensitive_lipase_like (raw)
SSGRENLYFQGMTELFVRPDVRGFLDFLNNLPGPKMHELDAPTARQMYVA
MKDVGDPPVGELGTLLDLSIPGPGGDIPARLYDPRASREPGPAIVFFHGG
GFVIGDLESHGSFTAEMARVLDLPVIAVDYRLAPEFPWPAAPDDCEAAAR
WVANSPAELGRSVTSLVLCGDSAGGNLVIVTAAALRDQPAKVPVIAQLPF
YPATDASKEYPSYAEFAEGYLLTRDSMEWFMAAYKSEADHIRSSPLLGDL
AGMPPAVVVTGGLDPIRDQGRAYAAALALAGVPVVFREAKGNIHGFITLR
KAIPSSVGDVMGAFAALKDIIVEAEGDRAMAQAAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SSGRENLYFQGMTELFVRPDVRGFLDFLNNLPGPKMHELDAPTARQMYVA
MKDVGDPPVGELGTLLDLSIPGPGGDIPARLYDPRASREPGPAIVFFHGG
GFVIGDLESHGSFTAEMARVLDLPVIAVDYRLAPEFPWPAAPDDCEAAAR
WVANSPAELGRSVTSLVLCGDSAGGNLVIVTAAALRDQPAKVPVIAQLPF
YPATDASKEYPSYAEFAEGYLLTRDSMEWFMAAYKSEADHIRSSPLLGDL
AGMPPAVVVTGGLDPIRDQGRAYAAALALAGVPVVFREAKGNIHGFITLR
KAIPSSVGDVMGAFAALKDIIVEAEGDRAMAQAAA


Reference
    Title: The Mobility of the Cap Domain Is Essential for the Substrate Promiscuity of a Family IV Esterase from Sorghum Rhizosphere Microbiome
    Distaso M, Cea-Rama I, Coscolin C, Chernikova TN, Tran H, Ferrer M, Sanz-Aparicio J, Golyshin PN
    Ref: Applied Environmental Microbiology, :e0180722, 2023 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer