Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bacl-a0a1a5wzh1

Brevibacillus sp. WF146. Alpha/beta hydrolase

Relationship
Family|BlEst2-lipase-like
Block| X
Position in NCBI Life Tree|Brevibacillus sp. WF146
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Brevibacillus: N E > unclassified Brevibacillus: N E > Brevibacillus sp. WF146: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LXGJ01000299, WP_065068122
1 UniProt : A0A1A5WZH1
1 UniProt : A0A1A5WZH1
1 Interpro : A0A1A5WZH1
1 Pfam : A0A1A5WZH1
1 PIRSF : A0A1A5WZH1
1 SUPERFAM : A0A1A5WZH1
Sequence
Graphical view for this peptide sequence: 9bacl-a0a1a5wzh1
Colored MSA for BlEst2-lipase-like (raw)
MSRRFLPALLAPSLTLALAWPTAAAAAPSLTLHDDNPNGKSGDWYTGAIP
PNASDDKPVLLFVQGLHSDYTTWTADDDYYTAAYNAGYRTAFVQLPDADG
AGGSMWTNGSVLADVIKKAANYYHVPQINVIAHSKGGIDTQAALVHYGAH
PYVNVVHQLGTPNKGSELADLAYSDWTWWLAEILGMRDDAVYSLQTSYMA
QFREQTDSRPEARKAATYMGAATGDDGWFSATWFAHAVLPGSDDGAVSLD
SAFGLPYGIRAFTDNGSEKLSHSMLRHASKTWEQVRPKLKLAFAGLSKAG
AAEAEWADAGLAEEADQAVRVPARSGDEAAGAIYRGGEVDGVQTERIPLE
GGIENVLIDIMVADKATAVELISPSGEVYKPEEGEAVPDELGIFGKAVHR
VFSLDKPEKGEWTAKISGERDAYFLLAAVQGGVDLKWRADKQVFKKNDTA
SLQLATRSGKAKQTSLQQAALRRSGSGKGTALQQLRVHAASDSEMNVRFQ
VPSEPGVYNLSFEVSGVDESGEAFTRSVNYNFAVTDEDGEIPRPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRRFLPALLAPSLTLALAWPTAAAAAPSLTLHDDNPNGKSGDWYTGAIP
PNASDDKPVLLFVQGLHSDYTTWTADDDYYTAAYNAGYRTAFVQLPDADG
AGGSMWTNGSVLADVIKKAANYYHVPQINVIAHSKGGIDTQAALVHYGAH
PYVNVVHQLGTPNKGSELADLAYSDWTWWLAEILGMRDDAVYSLQTSYMA
QFREQTDSRPEARKAATYMGAATGDDGWFSATWFAHAVLPGSDDGAVSLD
SAFGLPYGIRAFTDNGSEKLSHSMLRHASKTWEQVRPKLKLAFAGLSKAG
AAEAEWADAGLAEEADQAVRVPARSGDEAAGAIYRGGEVDGVQTERIPLE
GGIENVLIDIMVADKATAVELISPSGEVYKPEEGEAVPDELGIFGKAVHR
VFSLDKPEKGEWTAKISGERDAYFLLAAVQGGVDLKWRADKQVFKKNDTA
SLQLATRSGKAKQTSLQQAALRRSGSGKGTALQQLRVHAASDSEMNVRFQ
VPSEPGVYNLSFEVSGVDESGEAFTRSVNYNFAVTDEDGEIPRPE



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer