Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bacl-a0a0k9yzi1

Brevibacillus reuszeri Uncharacterized protein

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Brevibacillus reuszeri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Brevibacillus: N E > Brevibacillus reuszeri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_049738128
1 UniProt : A0A0K9YZI1
1 Interpro : A0A0K9YZI1
1 Pfam : A0A0K9YZI1
1 PIRSF : A0A0K9YZI1
1 SUPERFAM : A0A0K9YZI1
Sequence
Graphical view for this peptide sequence: 9bacl-a0a0k9yzi1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MGVHPQVQAVLSRLAELNFPSIETAPLSEIREAFSYSRTQMKEVIAPVAS
IEDRTLVSPDTEIPIRIYTPEGPGPHPVLVFFHGGGFVLGDLDTTHNICR
YLAWSANCVVVSVDYRLAPEHKFPAAMEDAYFATKWVAENAASFGGDATR
IAVGGESAGGNLAAVVSLLARDGGGPAIIYQLLIYPAVYFGLDSQSCIEC
GNKYNLTVDEMVWFRDHYLNGPDDEKNPLVAPLLASDLSGLPPALVVTAE
FDPIRDDGEAYAARLVEHGVKATAIRYEGMVHTFLNFSGEVDQSKTALDE
IAAGLRNAFLPGEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVHPQVQAVLSRLAELNFPSIETAPLSEIREAFSYSRTQMKEVIAPVAS
IEDRTLVSPDTEIPIRIYTPEGPGPHPVLVFFHGGGFVLGDLDTTHNICR
YLAWSANCVVVSVDYRLAPEHKFPAAMEDAYFATKWVAENAASFGGDATR
IAVGGESAGGNLAAVVSLLARDGGGPAIIYQLLIYPAVYFGLDSQSCIEC
GNKYNLTVDEMVWFRDHYLNGPDDEKNPLVAPLLASDLSGLPPALVVTAE
FDPIRDDGEAYAARLVEHGVKATAIRYEGMVHTFLNFSGEVDQSKTALDE
IAAGLRNAFLPGEK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer