Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9arch-q5g935

uncultured archaeon Thermophilic and Thermostable carboxylesterase (EC 3.1.1.1) Este1

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured archaeon
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > environmental samples: N E > uncultured archaeon: N E


Molecular evidence
Database
No mutation
1 structure:
2C7B: The Crystal Structure of Este1, a New Thermophilic and Thermostable Carboxylesterase Cloned from a Metagenomic Library
No kinetic





No Substrate
No inhibitor
1 Genbank : AY726780
1 UniProt : Q5G935
1 Structure : 2C7B
1 UniProt : Q5G935
1 Interpro : Q5G935
1 Pfam : Q5G935
1 PIRSF : Q5G935
1 SUPERFAM : Q5G935
Sequence
Graphical view for this peptide sequence: 9arch-q5g935
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPLDPQIKPILERIRALSIAASPQELRRQVEEQSRLLTAAVQEPIAETRD
VHIPVSGGSIRARVYFPKKAAGLPAVLYYHGGGFVFGSIETHDHICRRLS
RLSDSVVVSVDYRLAPEYKFPTAVEDAYAALKWVADRADELGVDPDRIAV
AGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNMTGVPTASLVEFGV
AETTSLPIELMVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAEY
DPLRDEGELYAYKMKASGSRAVAVRFAGMVHGFVSFYPFVDAGREALDLA
AASIRSGLQPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLDPQIKPILERIRALSIAASPQELRRQVEEQSRLLTAAVQEPIAETRD
VHIPVSGGSIRARVYFPKKAAGLPAVLYYHGGGFVFGSIETHDHICRRLS
RLSDSVVVSVDYRLAPEYKFPTAVEDAYAALKWVADRADELGVDPDRIAV
AGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNMTGVPTASLVEFGV
AETTSLPIELMVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAEY
DPLRDEGELYAYKMKASGSRAVAVRFAGMVHGFVSFYPFVDAGREALDLA
AASIRSGLQPS


References
2 more
    Title: Crystal structure of hyperthermophilic esterase EstE1 and the relationship between its dimerization and thermostability properties
    Byun JS, Rhee JK, Kim ND, Yoon J, Kim DU, Koh E, Oh JW, Cho HS
    Ref: BMC Struct Biol, 7:47, 2007 : PubMed

            

    Title: Crystallization and preliminary X-ray crystallographic analysis of EstE1, a new and thermostable esterase cloned from a metagenomic library
    Byun JS, Rhee JK, Kim DU, Oh JW, Cho HS
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 62:145, 2006 : PubMed

            

    Title: New thermophilic and thermostable esterase with sequence similarity to the hormone-sensitive lipase family, cloned from a metagenomic library
    Rhee JK, Ahn DG, Kim YG, Oh JW
    Ref: Applied Environmental Microbiology, 71:817, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer