Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9arch-PET46

Candidatus Bathyarchaeota archaeon, archaeal lid-containing feruloyl-esterase, polyethylene terephthalate hydrolase (PET)PET46 PETase/FAE

Relationship
Family|FAE-Bacterial-promiscuous
Block| X
Position in NCBI Life Tree|Candidatus Bathyarchaeota archaeon
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Candidatus Bathyarchaeota: N E > unclassified Candidatus Bathyarchaeota: N E


Molecular evidence
Database
No mutation
1 structure:
8B4U: The crystal structure of PET46 archaeal lid-containing feruloyl-esterase PETase
No kinetic





4 substrates (e.g. : BHET, Ethyl-cinnamate, MHET... more)
No inhibitor
1 Genbank : RLI42440
1 UniProt : A0A497NK85
1 Structure : 8B4U
1 UniProt : A0A497NK85
1 Interpro : A0A497NK85
1 Pfam : A0A497NK85
1 PIRSF : A0A497NK85
1 SUPERFAM : A0A497NK85
Sequence
Graphical view for this peptide sequence: 9arch-PET46
Colored MSA for FAE-Bacterial-promiscuous (raw)
MIKPVTFMSEGEQIIGVLHVPDDLRGDKRAPAIAMFHGFTGNKSEAHRLF
VHVARSLCNDGFVVLRFDFRGSGDSDGEFEDMTVPGEVCDASRSIDFLSE
LNFVDSERIGVLGLSMGGRVAAILASKDRRIKFVILYSAALTPLRRKFLE
GLEKESIRRLEMGEAVHVGNGWYLKKGFFETVDSIVPLDVLDRIRVPVLI
IHGDSDSVIPLDGALKGYEIIRDLNDKNELYIVRGGDHVFTRREHTIEVI
ERTLDWLRSLNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIKPVTFMSEGEQIIGVLHVPDDLRGDKRAPAIAMFHGFTGNKSEAHRLF
VHVARSLCNDGFVVLRFDFRGSGDSDGEFEDMTVPGEVCDASRSIDFLSE
LNFVDSERIGVLGLSMGGRVAAILASKDRRIKFVILYSAALTPLRRKFLE
GLEKESIRRLEMGEAVHVGNGWYLKKGFFETVDSIVPLDVLDRIRVPVLI
IHGDSDSVIPLDGALKGYEIIRDLNDKNELYIVRGGDHVFTRREHTIEVI
ERTLDWLRSLNL


Reference
    Title: An archaeal lid-containing feruloyl esterase degrades polyethylene terephthalate
    Perez-Garcia P, Chow J, Costanzi E, Gurschke M, Dittrich J, Dierkes RF, Molitor R, Applegate V, Feuerriegel G and Streit WR <9 more author(s)>
    Ref: Commun Chem, 6:193, 2023 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer