(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Alteromonadales: NE > Alteromonadaceae: NE > Marinobacter: NE > Marinobacter manganoxydans: NE > Marinobacter manganoxydans MnI7-9: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MKLIKTKGYESNPEVVLILAHGAGAPADSAFMEELSLALSREGIVTVRFE FPYMQKRRADGRKRPPDREPALLEHFSSVVDAVRAELGAECKVLVGGKSM GGRMASILASQRNGIDGVTCFGYPFHPPGKLDRWRTGHFQELKSPMLVLQ GTRDPFGKPAEMVGHEKELEAIRLHWLEGGNHDFQPLKSQPHTQSELVAE AARETRAFINQELVT
Here we report the draft genome of Marinobacter manganoxydans MnI7-9, isolated from a deep-sea hydrothermal vent in the Indian Ocean and capable of oxidizing manganese even when there is a very high concentration of Mn(2+). The strain also displayed high resistance and adsorption ability toward many metal(loid)s.