Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9agar-d5grp3

Pleurotus sapidus Esterase 1 SF12 Feruoyl esterase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Pleurotus sapidus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Pleurotaceae: N E > Pleurotus: N E > Pleurotus sapidus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FN552459, CBE71381
1 UniProt : D5GRP3
1 UniProt : D5GRP3
1 Interpro : D5GRP3
1 Pfam : D5GRP3
1 PIRSF : D5GRP3
1 SUPERFAM : D5GRP3
Sequence
Graphical view for this peptide sequence: 9agar-d5grp3
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MVLLRAVAAALALLPFIAAQAPQVQVGNTAIIGRSIPEFSKEFFGGIPFA
EPPVGQLRLNNPVLKTRLDTPTFDAGNYGPACLQPDPSVPVISEDCLRIN
VLRTAGVPAGVLLPVMAWVYGGGFDFGDSSIYNASAIVAQSALRGTPVVF
VSLNYRLGPLGFPKGQEAHDRGALNLGLKDQLAALEWVQANIGFFGGDKS
KVTVFGQSAGSICLSIHFLNSPIQSLARAAIFESGFPATSQNFPAAHREK
SWTNFVKDIPQCASTAGSKDTFSCLRSDTIDQATLLQAGALADDQSGELF
AWDPTIDGPGGILPDIPSKLLAKGKFVRLPFIAGTVLDEATTFTPKTVTT
EDQIRQSLIANFTPSPFGPTVLAKDVETILKLYPDIPALGSPFGTGNETF
GLSSQYKRTAAIFGDLSFQSQRRSWIQTLSKAGVKTFGYLFTDPQSSNPA
NGVSHASEIPYVYGAPGIFGGTVTPEAIALSRIMVDYWVSFATSLDPNDG
KGFPRPVWTQYTPSNQAIMLLNSTGTSMIPDDYRKKQIDFINSNPAVWHH
RRSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVLLRAVAAALALLPFIAAQAPQVQVGNTAIIGRSIPEFSKEFFGGIPFA
EPPVGQLRLNNPVLKTRLDTPTFDAGNYGPACLQPDPSVPVISEDCLRIN
VLRTAGVPAGVLLPVMAWVYGGGFDFGDSSIYNASAIVAQSALRGTPVVF
VSLNYRLGPLGFPKGQEAHDRGALNLGLKDQLAALEWVQANIGFFGGDKS
KVTVFGQSAGSICLSIHFLNSPIQSLARAAIFESGFPATSQNFPAAHREK
SWTNFVKDIPQCASTAGSKDTFSCLRSDTIDQATLLQAGALADDQSGELF
AWDPTIDGPGGILPDIPSKLLAKGKFVRLPFIAGTVLDEATTFTPKTVTT
EDQIRQSLIANFTPSPFGPTVLAKDVETILKLYPDIPALGSPFGTGNETF
GLSSQYKRTAAIFGDLSFQSQRRSWIQTLSKAGVKTFGYLFTDPQSSNPA
NGVSHASEIPYVYGAPGIFGGTVTPEAIALSRIMVDYWVSFATSLDPNDG
KGFPRPVWTQYTPSNQAIMLLNSTGTSMIPDDYRKKQIDFINSNPAVWHH
RRSF


Reference
    Title: Heterologous production of a feruloyl esterase from Pleurotus sapidus synthesizing feruloyl-saccharide esters
    Kelle S, Nieter A, Krings U, Zelena K, Linke D, Berger RG
    Ref: Biotechnol Appl Biochem, 63:852, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer