Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-a0a1c4wj17

Micromonospora haikouensis. Poly(3-hydroxybutyrate) depolymerase

Comment
c-term CBM2 Cellulose-binding protein excluded


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Micromonospora haikouensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micromonosporales: N E > Micromonosporaceae: N E > Micromonospora: N E > Micromonospora haikouensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FMCW01000016
1 UniProt : A0A1C4WJ17
1 UniProt : A0A1C4WJ17
1 Interpro : A0A1C4WJ17
1 Pfam : A0A1C4WJ17
1 PIRSF : A0A1C4WJ17
1 SUPERFAM : A0A1C4WJ17
Sequence
Graphical view for this peptide sequence: 9actn-a0a1c4wj17
Colored MSA for FaeC (raw)
MSTCRSRFASIAVAMLLTLGTAGTLVGGGLGGTARAAEVGAAAATAGCGK
APTLASGTHTIQSNGKNRTFILRVPDGYDANRPYRLVFGFHWYGGTAVDV
ATGQTVQRDVWAYYGLLRLAENSTIFVAPQGINNGWANSGGEDITFVDDM
LRRIEGGLCVDTTQRFSVGFSYGGSMSYALACARPDVFRAVAVQSAPGTL
SGCSGGTQPFAYLGVHGISDNIAGGRSLRDRFVRNNGCTAASPPEPRAGS
LTHTVFSYSGCRSGYPVVWAAFDGGHIAAPQDGAGGDSGSRTWVPGEVWR
FFTQFAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTCRSRFASIAVAMLLTLGTAGTLVGGGLGGTARAAEVGAAAATAGCGK
APTLASGTHTIQSNGKNRTFILRVPDGYDANRPYRLVFGFHWYGGTAVDV
ATGQTVQRDVWAYYGLLRLAENSTIFVAPQGINNGWANSGGEDITFVDDM
LRRIEGGLCVDTTQRFSVGFSYGGSMSYALACARPDVFRAVAVQSAPGTL
SGCSGGTQPFAYLGVHGISDNIAGGRSLRDRFVRNNGCTAASPPEPRAGS
LTHTVFSYSGCRSGYPVVWAAFDGGHIAAPQDGAGGDSGSRTWVPGEVWR
FFTQFAG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer