Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibpa-VPA1496

Vibrio parahaemolyticus, Vibrio alginolyticus, Vibrio harveyi, Vibrio sp. prolyl endopeptidase

Comment
Other strains: Vibrio parahaemolyticus (serotype O3:K6 (strain RIMD 2210633); AQ3810; AQ4037; K5030; AN-5034; Peru-466), Vibrio harveyi (HY01; ATCC BAA-1116 / BB120; 1DA3), Vibrio alginolyticus (40B; 12G01), Vibrio sp. (strain Ex25)


Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Vibrio parahaemolyticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio harveyi group: N E > Vibrio parahaemolyticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP005089, AAPS01000001
>3 UniProt links 2 more: Q87G21, A7N343, D0WUS3
>3 UniProt links 2 more: Q87G21, A7N343, D0WUS3
>3 Interpro links 2 more: Q87G21, A7N343, D0WUS3
>3 Pfam links 2 more: Q87G21, A7N343, D0WUS3
>3 PIRSF links 2 more: Q87G21, A7N343, D0WUS3
>3 SUPERFAM links 2 more: Q87G21, A7N343, D0WUS3
Sequence
Graphical view for this peptide sequence: vibpa-VPA1496
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MHYPKTRKDSVVDTYFGHDIADPYRWLEDDRSEETAQWVSGQNSVTFDFL
GQIPYRQQIRDLVANSQNYEKYSQPFVRGDYTYFYKNDGLQNQSVLYRRK
GEGEAEVFLDPNTFSEEGTTSLGEVSFSKDYRLVAYSISEGGSDWRKIFV
IDTETKEQLEPEIVDAKFTSISWLGSKGFYYSSYDKPQGSELSARTEHHK
LYYHELGTPQSEDKVIFGELGAQIHRYVSGTTTTDDRFLIISGAESTSGN
RLFYIDLQSDSQAIVTLRDTTQGDTYLIDSQDETLLLYTNLDAPNGKVVS
YNTQTEQWADVIAEQEQPLEISKGGGYLFATYMVDVLSKVQQFTYQGEWI
RDVELPGEGTAYGLAGKKEETTLYYTFTNYVTPPTIFSFDVESGASTLYQ
ESKAPFDRNEYESKQVFYTSKDGTQVPMIISYKKGISLDGSAPTMLYGYG
GFNISLTPMFSGNVANWLELGGIYAVANMRGGGEYGKAWHNAGTQQQKQN
VFDDFIAAAEYLIENDYTSSERLAIRGGSNGGLLVGACMTQRPELFKVAL
PAVGVLDMLRYHTFTSGEGWKYDYGTSEQSEAMFQYLLGYSPVHNVKEGV
QYPATLVTTADHDDRVVPAHSYKFIAELQDKQQGENPVLIRIDVNAGHGA
GMPLSKQIDLTTDVYAFTLYNMGIESI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHYPKTRKDSVVDTYFGHDIADPYRWLEDDRSEETAQWVSGQNSVTFDFL
GQIPYRQQIRDLVANSQNYEKYSQPFVRGDYTYFYKNDGLQNQSVLYRRK
GEGEAEVFLDPNTFSEEGTTSLGEVSFSKDYRLVAYSISEGGSDWRKIFV
IDTETKEQLEPEIVDAKFTSISWLGSKGFYYSSYDKPQGSELSARTEHHK
LYYHELGTPQSEDKVIFGELGAQIHRYVSGTTTTDDRFLIISGAESTSGN
RLFYIDLQSDSQAIVTLRDTTQGDTYLIDSQDETLLLYTNLDAPNGKVVS
YNTQTEQWADVIAEQEQPLEISKGGGYLFATYMVDVLSKVQQFTYQGEWI
RDVELPGEGTAYGLAGKKEETTLYYTFTNYVTPPTIFSFDVESGASTLYQ
ESKAPFDRNEYESKQVFYTSKDGTQVPMIISYKKGISLDGSAPTMLYGYG
GFNISLTPMFSGNVANWLELGGIYAVANMRGGGEYGKAWHNAGTQQQKQN
VFDDFIAAAEYLIENDYTSSERLAIRGGSNGGLLVGACMTQRPELFKVAL
PAVGVLDMLRYHTFTSGEGWKYDYGTSEQSEAMFQYLLGYSPVHNVKEGV
QYPATLVTTADHDDRVVPAHSYKFIAELQDKQQGENPVLIRIDVNAGHGA
GMPLSKQIDLTTDVYAFTLYNMGIESI


References
    Title: Comparative genomic analysis of Vibrio parahaemolyticus: serotype conversion and virulence
    Chen Y, Stine OC, Badger JH, Gil AI, Nair GB, Nishibuchi M, Fouts DE
    Ref: BMC Genomics, 12:294, 2011 : PubMed

            

    Title: Genomic taxonomy of Vibrios
    Thompson CC, Vicente AC, Souza RC, Vasconcelos AT, Vesth T, Alves N, Jr., Ussery DW, Iida T, Thompson FL
    Ref: BMC Evol Biol, 9:258, 2009 : PubMed

            

    Title: Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V cholerae
    Makino K, Oshima K, Kurokawa K, Yokoyama K, Uda T, Tagomori K, Iijima Y, Najima M, Nakano M and Iida T <7 more author(s)>
    Ref: Lancet, 361:743, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer