Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibpa-VP1677

Vibrio parahaemolyticus hypothetical protein

Relationship
Family|YcjY-like
Block| X
Position in NCBI Life Tree|Vibrio parahaemolyticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio harveyi group: N E > Vibrio parahaemolyticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP005078
1 UniProt : Q87P41
1 Interpro : Q87P41
1 Pfam : Q87P41
1 PIRSF : Q87P41
1 SUPERFAM : Q87P41
Sequence
Graphical view for this peptide sequence: vibpa-VP1677
Colored MSA for YcjY-like (raw)
MCVKRYLSNTVRSLVLTQGLRPTRQNSETLQENFVMSKVTFKNLNGLGIS
IAAVINVPENFDESKPYPAIVVSHPGGGVKEQTAGTYAKKLSEHGFVTIA
FDASFQGESTGEPRQLENPHIRTEDVSAVIDYLTTLDYVDNERIGAMGIC
AGAGYTANAAINDRRIKAVGTVSMVNIGQMFRNGWDNSVKDSDAIPYIEA
GSLARTSDASGAEFVTIPMAPLKEEDAPNEELRQAWEYYHTDRAAYCTAP
GFATARSLNQIITYDAFFKAEAFLTQPLLTVVGSEAGSKWMSDDLMERAA
STDKHMYVVDGANHMDLYDGETPIAEAIGALAPFFQRTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCVKRYLSNTVRSLVLTQGLRPTRQNSETLQENFVMSKVTFKNLNGLGIS
IAAVINVPENFDESKPYPAIVVSHPGGGVKEQTAGTYAKKLSEHGFVTIA
FDASFQGESTGEPRQLENPHIRTEDVSAVIDYLTTLDYVDNERIGAMGIC
AGAGYTANAAINDRRIKAVGTVSMVNIGQMFRNGWDNSVKDSDAIPYIEA
GSLARTSDASGAEFVTIPMAPLKEEDAPNEELRQAWEYYHTDRAAYCTAP
GFATARSLNQIITYDAFFKAEAFLTQPLLTVVGSEAGSKWMSDDLMERAA
STDKHMYVVDGANHMDLYDGETPIAEAIGALAPFFQRTL


Reference
    Title: Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V cholerae
    Makino K, Oshima K, Kurokawa K, Yokoyama K, Uda T, Tagomori K, Iijima Y, Najima M, Nakano M and Iida T <7 more author(s)>
    Ref: Lancet, 361:743, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer