Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thet2-q72j75

Thermus thermophilus hyper-thermoalkalophilic esterase E34Tt KLEST-3S estC55-38 estC76-179 estC76-218

Comment
Other strains: Thermus thermophilus (strains HB27 / ATCC BAA-163 / DSM 7039; HB8 / ATCC 27634 / DSM 579; SG0.5JP17-16; JL-18); uncultured bacterium


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Thermus thermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Deinococcus-Thermus: N E > Deinococci: N E > Thermales: N E > Thermaceae: N E > Thermus: N E > Thermus thermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: thet2-q72j75
Colored MSA for Pectinacetylesterase-Notum (raw)
MKRLIALVLLFALALAQGLEAFWKAVEVPGGVCADGSPYRFYVSPGDPRK
VVVDFQGGGACWDQATCGPESRTYRKRVDVQELYLAQGIYNRMSVANPFF
GWTHVFVPYCTGDLHVGRATVDYGGFKVHHQGARNAQAALEYVFRNHTNP
ERVFVTGCSAGAYGAVLWADKILATYKNAQIAVCGDAGVGVVTEDFPGFT
AWNPRLPELPGLSSPPKVSEIYRALAQAYPKAVLAQYTTLLDGTQIYFYA
LMKKEAAPSEATAREWAVAAERAVGFPASEANYTYYLAPGSQHCILPRPE
LYTLKVGEVSFLDWLRALAEGRTPPRVRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRLIALVLLFALALAQGLEAFWKAVEVPGGVCADGSPYRFYVSPGDPRK
VVVDFQGGGACWDQATCGPESRTYRKRVDVQELYLAQGIYNRMSVANPFF
GWTHVFVPYCTGDLHVGRATVDYGGFKVHHQGARNAQAALEYVFRNHTNP
ERVFVTGCSAGAYGAVLWADKILATYKNAQIAVCGDAGVGVVTEDFPGFT
AWNPRLPELPGLSSPPKVSEIYRALAQAYPKAVLAQYTTLLDGTQIYFYA
LMKKEAAPSEATAREWAVAAERAVGFPASEANYTYYLAPGSQHCILPRPE
LYTLKVGEVSFLDWLRALAEGRTPPRVRP


References
4 more
    Title: Reactivity of a Recombinant Esterase from Thermus thermophilus HB27 in Aqueous and Organic Media
    Gonzalez-Gonzalez R, Fucinos P, Beneventi E, Lopez-Lopez O, Pampin B, Rodriguez R, Gonzalez-Siso MI, Cruces J, Rua ML
    Ref: Microorganisms, 10:, 2022 : PubMed

            

    Title: An esterase from Thermus thermophilus HB27 with hyper-thermoalkalophilic properties: Purification, characterisation and structural modelling
    Fucinos P, Pastrana L, Sanroman A, Longo MA, Hermoso JA, Rua ML
    Ref: J Mol Catal B Enzym, 70:127, 2011 : PubMed

            

    Title: Heterologous expression of an esterase from Thermus thermophilus HB27 in Saccharomyces cerevisiae
    Lopez-Lopez O, Fucinos P, Pastrana L, Rua ML, Cerdan ME, Gonzalez-Siso MI
    Ref: J Biotechnol, 145:226, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer