Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thaca-l8x532

Thanatephorus cucumeris (strain AG1-IA) (Rice sheath blight fungus) (Rhizoctonia solani) Crystal protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Thanatephorus cucumeris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetes incertae sedis: N E > Cantharellales: N E > Ceratobasidiaceae: N E > Thanatephorus: N E > Thanatephorus cucumeris: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AFRT01000084
1 UniProt : L8X532
1 UniProt : L8X532
1 Interpro : L8X532
1 Pfam : L8X532
1 PIRSF : L8X532
1 SUPERFAM : L8X532
Sequence
Graphical view for this peptide sequence: thaca-l8x532
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MPGISLSLASPSGLSFAPSQHHHLPRRKARGHTDSGQPVLFLATPLNLAT
HRIPHLHIMFIGNLIRTLPILGIAATAVDASPVPTFGQGSPSLRGVLCAL
PIVRTLCRKDTGEVDVLTPVGMARGLQTTSTSSRFVVQYASASRWGLPTK
ANAWNIPGNDINKMPPMCPQPNVPASTYSEDCLYMAIYTPVPSPSVLSNV
PILVWYVENQKKKYSLIKDVPRVHGGSFEVGSASDPGLDGAALAKGTNSI
VVVVQYRLGAFGLVPPTSMSGNSNLAVRDVITSLQFARQVLPSFGGDINK
ITLAGQSSGAQMIRALLGTPSASGLFSYAALHSDTMDYGFYKPQTITDLQ
TQLYTNTSGPLAACNDSACQMGISLPDIISAQEEMRNKVQNMYPVTLSGS
PIRPVHDGQLLQYTMTGNSFPPAANMKPVLVMTVKDEAGNSIGTNLPAGF
PASYFAIPVTTFLGTGRTSTIETSGNYDPDAYGAQAGYTNDSDNTRNAIT
QLFTDGYWRCPSWTFSRSWASKGGVVYTGEFQNGATYYANQNNAYCKQSG
MVCHQDDIYILFGTTPSPTSAQTALTQEIQSRYSSFIRSGVPNPSSGSYA
AWAQSGSTDVAALKLGGTGTRPAEACDPTFWGSQVPYDYQVYGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPGISLSLASPSGLSFAPSQHHHLPRRKARGHTDSGQPVLFLATPLNLAT
HRIPHLHIMFIGNLIRTLPILGIAATAVDASPVPTFGQGSPSLRGVLCAL
PIVRTLCRKDTGEVDVLTPVGMARGLQTTSTSSRFVVQYASASRWGLPTK
ANAWNIPGNDINKMPPMCPQPNVPASTYSEDCLYMAIYTPVPSPSVLSNV
PILVWYVENQKKKYSLIKDVPRVHGGSFEVGSASDPGLDGAALAKGTNSI
VVVVQYRLGAFGLVPPTSMSGNSNLAVRDVITSLQFARQVLPSFGGDINK
ITLAGQSSGAQMIRALLGTPSASGLFSYAALHSDTMDYGFYKPQTITDLQ
TQLYTNTSGPLAACNDSACQMGISLPDIISAQEEMRNKVQNMYPVTLSGS
PIRPVHDGQLLQYTMTGNSFPPAANMKPVLVMTVKDEAGNSIGTNLPAGF
PASYFAIPVTTFLGTGRTSTIETSGNYDPDAYGAQAGYTNDSDNTRNAIT
QLFTDGYWRCPSWTFSRSWASKGGVVYTGEFQNGATYYANQNNAYCKQSG
MVCHQDDIYILFGTTPSPTSAQTALTQEIQSRYSSFIRSGVPNPSSGSYA
AWAQSGSTDVAALKLGGTGTRPAEACDPTFWGSQVPYDYQVYGL


Reference
    Title: The evolution and pathogenic mechanisms of the rice sheath blight pathogen
    Zheng A, Lin R, Zhang D, Qin P, Xu L, Ai P, Ding L, Wang Y, Chen Y and Li P <15 more author(s)>
    Ref: Nat Commun, 4:1424, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer