Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tetng-3neur

Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment) preliminary entry

Comment
Q4SJR6 and Q4SJR7 and Q4SJR8 probably fragments of the same gene connected splicing not sure


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Tetraodon nigroviridis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Tetraodontiformes: N E > Tetraodontoidei: N E > Tetradontoidea: N E > Tetraodontidae: N E > Tetraodon: N E > Tetraodon nigroviridis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CAAE01014573, GQ489230
>3 UniProt links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
>3 UniProt links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
>3 Interpro links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
>3 Pfam links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
>3 PIRSF links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
>3 SUPERFAM links 2 more: Q4SJR6, Q4SJR7, Q4SJR8
Sequence
Graphical view for this peptide sequence: tetng-3neur
Colored MSA for Neuroligin (raw)
GAGLGVSLWVLSFCWCFAEGQNYHPTVNTQYGKLRGVRVPLPSEILGPVD
QYLGVPYAASPVGEKRFLPPEPPSSWSGIKNATHFAPVCPQNIHNAVPEI
MMPIWFTFNLDIVTTYIQDQHEDCLYLNIYVPTEDVKCNKLLKLFQDQMC
ENLRAHAKKQGEDFSDNDGDEDEDIRDTGAKPVMVYIHGGSYMEGTGNMI
DGSVLASYGNVIVITLNYRVGVLGGFLSTGDQAAKGNYGLLDQIQALRWI
SENIGFFGGDSNRITVFGSGIGASCVSLLTLSHHSEGLFHRAIIQSGSAL
SSWAVNYQPVKYTRFLAEKVGCNVLDTLDMVDCLRKKSFRELVEQDIQPA
RVPRSLWTCNMEQGEFLNYDIMLGVNQGEGLRFVENVVDSEDGVSGNDFD
FSVSDFVDSLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYV
FGIPMIGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKF
IHTKANRFEEVAWSKYNPQDQLYLHIGLKPRVRDHYRATKVAFWKHLVPH
LYNLHDMFHYTSTTTKVPPPEATQNTVSTKRPNGKTSRPSNTKRPPMSPA
YNSEDKDSWNEDKTGPRVVENPRDYSTELSVTIAVGASLLFLNVLAFAAL
YYRKDKRRQDSGHGQPSPQHQTTANDIGHHAPEEEIMSLQMNQTHHECDA
GNSNEGALRLAALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGMPNLHP
YNTFTTGFNSTGLPHSHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GAGLGVSLWVLSFCWCFAEGQNYHPTVNTQYGKLRGVRVPLPSEILGPVD
QYLGVPYAASPVGEKRFLPPEPPSSWSGIKNATHFAPVCPQNIHNAVPEI
MMPIWFTFNLDIVTTYIQDQHEDCLYLNIYVPTEDVKCNKLLKLFQDQMC
ENLRAHAKKQGEDFSDNDGDEDEDIRDTGAKPVMVYIHGGSYMEGTGNMI
DGSVLASYGNVIVITLNYRVGVLGGFLSTGDQAAKGNYGLLDQIQALRWI
SENIGFFGGDSNRITVFGSGIGASCVSLLTLSHHSEGLFHRAIIQSGSAL
SSWAVNYQPVKYTRFLAEKVGCNVLDTLDMVDCLRKKSFRELVEQDIQPA
RVPRSLWTCNMEQGEFLNYDIMLGVNQGEGLRFVENVVDSEDGVSGNDFD
FSVSDFVDSLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYV
FGIPMIGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKF
IHTKANRFEEVAWSKYNPQDQLYLHIGLKPRVRDHYRATKVAFWKHLVPH
LYNLHDMFHYTSTTTKVPPPEATQNTVSTKRPNGKTSRPSNTKRPPMSPA
YNSEDKDSWNEDKTGPRVVENPRDYSTELSVTIAVGASLLFLNVLAFAAL
YYRKDKRRQDSGHGQPSPQHQTTANDIGHHAPEEEIMSLQMNQTHHECDA
GNSNEGALRLAALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGMPNLHP
YNTFTTGFNSTGLPHSHSTTRV


References
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            

    Title: Genome duplication in the teleost fish Tetraodon nigroviridis reveals the early vertebrate proto-karyotype
    Jaillon O, Aury JM, Brunet F, Petit JL, Stange-Thomann N, Mauceli E, Bouneau L, Fischer C, Ozouf-Costaz C and Roest Crollius H <51 more author(s)>
    Ref: Nature, 431:946, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer