Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strgg-b1vn62

Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) Putative epoxide hydrolase

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Streptomyces griseus subsp. griseus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces griseus group: N E > Streptomyces griseus subgroup: N E > Streptomyces griseus: N E > Streptomyces griseus subsp. griseus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP009493
1 UniProt : B1VN62
1 UniProt : B1VN62
1 Interpro : B1VN62
1 Pfam : B1VN62
1 PIRSF : B1VN62
1 SUPERFAM : B1VN62
Sequence
Graphical view for this peptide sequence: strgg-b1vn62
Colored MSA for Epoxide_hydrolase (raw)
MPEPAPVPTPSADRTARPSALLPGATHRILDVPGGRIHCVEQGTGPLVLL
VHGFPESWYSWRHQLPALAAAGHRAVAIDVRGYGRSSAPAAADAYRMLAH
VADNTAVVHALGEETATVVGHDWGSPIAANSALLRPDVFTAVALLSVPYT
PRGGPRPTDGFAGIGGEEEFYVSYFQTPGRAEAEIEPDVRGWLTGFYTAL
SGDAPASEDHPGPFFVPPGARMADRFPGGPLPGWLDERDLDVYAEEFERT
GLAGALNRYRNVDRDWEDLAAWDGVPVTQPSIFIGGALDASTTWMSDAIA
AYPRTLPGLSAAHVLEGCGHWIQQERPDEVNRLLTDWLHGLRRTTPGP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEPAPVPTPSADRTARPSALLPGATHRILDVPGGRIHCVEQGTGPLVLL
VHGFPESWYSWRHQLPALAAAGHRAVAIDVRGYGRSSAPAAADAYRMLAH
VADNTAVVHALGEETATVVGHDWGSPIAANSALLRPDVFTAVALLSVPYT
PRGGPRPTDGFAGIGGEEEFYVSYFQTPGRAEAEIEPDVRGWLTGFYTAL
SGDAPASEDHPGPFFVPPGARMADRFPGGPLPGWLDERDLDVYAEEFERT
GLAGALNRYRNVDRDWEDLAAWDGVPVTQPSIFIGGALDASTTWMSDAIA
AYPRTLPGLSAAHVLEGCGHWIQQERPDEVNRLLTDWLHGLRRTTPGP


References
    Title: Bioresolution of racemic phenyl glycidyl ether by a putative recombinant epoxide hydrolase from Streptomyces griseus NBRC 13350
    Saini P, Kumar N, Wani SI, Sharma S, Chimni SS, Sareen D
    Ref: World J Microbiol Biotechnol, 33:82, 2017 : PubMed

            

    Title: Genome sequence of the streptomycin-producing microorganism Streptomyces griseus IFO 13350
    Ohnishi Y, Ishikawa J, Hara H, Suzuki H, Ikenoya M, Ikeda H, Yamashita A, Hattori M, Horinouchi S
    Ref: Journal of Bacteriology, 190:4050, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer