Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strav-SAV2604

Streptomyces avermitilis hypothetical protein

Comment
only central part


Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Streptomyces avermitilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces avermitilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP005031
1 UniProt : Q82K00
1 Interpro : Q82K00
1 Pfam : Q82K00
1 PIRSF : Q82K00
1 SUPERFAM : Q82K00
Sequence
Graphical view for this peptide sequence: strav-SAV2604
Colored MSA for Chlorophyllase (raw)
ANSVDPGRPGSYRTVTGEYDLDPVKLPGFAQPVEMQAVVVAPEGATGKRP
LALFLHGRHTTCFKPGGSEDDVTIDWPCAAGTQPIPSHKGYLKDQKLLAS
QGYVTVSISANGINGQDGDAEDGGAQARSSLVRQHLAKWAGWAAHPGSAP
AGVPDAAEADLSRVLLVGHSRGGEGVNRAAMDSLYPPPAAQDGYRGPVRW
KIRGTVLIGPTIFGQNPVADVPSTTILPGCDGDVSDLQGEVYVDGTRGVS
RGTALHSAVYVVGANHNFFNTEW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ANSVDPGRPGSYRTVTGEYDLDPVKLPGFAQPVEMQAVVVAPEGATGKRP
LALFLHGRHTTCFKPGGSEDDVTIDWPCAAGTQPIPSHKGYLKDQKLLAS
QGYVTVSISANGINGQDGDAEDGGAQARSSLVRQHLAKWAGWAAHPGSAP
AGVPDAAEADLSRVLLVGHSRGGEGVNRAAMDSLYPPPAAQDGYRGPVRW
KIRGTVLIGPTIFGQNPVADVPSTTILPGCDGDVSDLQGEVYVDGTRGVS
RGTALHSAVYVVGANHNFFNTEW


References
    Title: Complete genome sequence and comparative analysis of the industrial microorganism Streptomyces avermitilis
    Ikeda H, Ishikawa J, Hanamoto A, Shinose M, Kikuchi H, Shiba T, Sakaki Y, Hattori M, Omura S
    Ref: Nat Biotechnol, 21:526, 2003 : PubMed

            

    Title: Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites
    Omura S, Ikeda H, Ishikawa J, Hanamoto A, Takahashi C, Shinose M, Takahashi Y, Horikawa H, Nakazawa H and Hattori M <4 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 98:12215, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer