Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strav-AVEA4

Streptomyces avermitilis typeIpolyketide synthase aves 4

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces avermitilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces avermitilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB032367
1 UniProt : Q9S0R3
1 Interpro : Q9S0R3
1 Pfam : Q9S0R3
1 PIRSF : Q9S0R3
1 SUPERFAM : Q9S0R3
Sequence
Graphical view for this peptide sequence: strav-AVEA4
Colored MSA for Thioesterase (raw)
PALICLPTVAAVSSVYQYSRFAAGLNGHRDVWYVPAPGFLEGEPLPSGIG
AVTRMFADAIVRFTDGAPFALAGHSAGGWFVYAVTSHLERLGVRPEAVVT
MDAYLPDDGIAPVASALTSEIFDRVTQFVDVDYTRLVAMGGYFRIFSGWS
PPDITTPALFLRGRDGEQMPPPWGVPHTVLDIQGNHFTMLEQFADSTARH
VDEWLTEIASVRR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PALICLPTVAAVSSVYQYSRFAAGLNGHRDVWYVPAPGFLEGEPLPSGIG
AVTRMFADAIVRFTDGAPFALAGHSAGGWFVYAVTSHLERLGVRPEAVVT
MDAYLPDDGIAPVASALTSEIFDRVTQFVDVDYTRLVAMGGYFRIFSGWS
PPDITTPALFLRGRDGEQMPPPWGVPHTVLDIQGNHFTMLEQFADSTARH
VDEWLTEIASVRR


Reference
    Title: Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis.
    Ikeda H, Nonomiya T, Usami M, Ohta T, Omura S
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 96:9509, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer