Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sinfn-c3m9f4

Sinorhizobium fredii (strain NBRC 101917 / NGR234). Putative acid tolerance protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Sinorhizobium fredii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium fredii group: N E > Sinorhizobium fredii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP001389, WP_012707504, YP_002825473
1 UniProt : C3M9F4
1 UniProt : C3M9F4
1 Interpro : C3M9F4
1 Pfam : C3M9F4
1 PIRSF : C3M9F4
1 SUPERFAM : C3M9F4
Sequence
Graphical view for this peptide sequence: sinfn-c3m9f4
Colored MSA for VirJ (raw)
MTLIGTIARAAILTTLVAGAASLPAAADDAQKFDTGMIPSPHILFPKQEA
TGLVVLLSDSGGWSSKEDTVARSLSDDNAIVIGIDLKAYLAALAKDDGDC
IYTVSDIESLSQQVQRAAGSGAYRPPVVAGVGAGGAMALAIAAQSPAATI
GRTLAIDPEEGIALTKQLCTPAEKSRKGDRMVYGLTDGPLPDPVAVTFSS
AVSADGRAHVAALVGKHSEIETDDTDDDAYAALSDALSGYLDEDDEADNP
FGLPLTVLDAKPSRATMAVIYSGDGGWRDIDKEVGNVLQQQGVPVVGVDS
LRYFWAERQPQETADDLARIIGYYGKRWNVRNVLLIGYSFGADILPRTYN
LLPPADRVRVRQVSLMALSHQADFKISVLGWLGAGGAGSAGDPVDDVKAI
DPARVQCFYGTEEEDDACPELKSSGADVVAIEGGHHFDEDYAALTRRVLD
GLDRRLAAAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLIGTIARAAILTTLVAGAASLPAAADDAQKFDTGMIPSPHILFPKQEA
TGLVVLLSDSGGWSSKEDTVARSLSDDNAIVIGIDLKAYLAALAKDDGDC
IYTVSDIESLSQQVQRAAGSGAYRPPVVAGVGAGGAMALAIAAQSPAATI
GRTLAIDPEEGIALTKQLCTPAEKSRKGDRMVYGLTDGPLPDPVAVTFSS
AVSADGRAHVAALVGKHSEIETDDTDDDAYAALSDALSGYLDEDDEADNP
FGLPLTVLDAKPSRATMAVIYSGDGGWRDIDKEVGNVLQQQGVPVVGVDS
LRYFWAERQPQETADDLARIIGYYGKRWNVRNVLLIGYSFGADILPRTYN
LLPPADRVRVRQVSLMALSHQADFKISVLGWLGAGGAGSAGDPVDDVKAI
DPARVQCFYGTEEEDDACPELKSSGADVVAIEGGHHFDEDYAALTRRVLD
GLDRRLAAAK


Reference
    Title: Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems
    Schmeisser C, Liesegang H, Krysciak D, Bakkou N, Le Quere A, Wollherr A, Heinemeyer I, Morgenstern B, Pommerening-Roser A and Streit WR <8 more author(s)>
    Ref: Applied Environmental Microbiology, 75:4035, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer