Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhime-R02478

Rhizobium meliloti (Sinorhizobium meliloti) Rhizobium sp. (strain NGR234) putative haloperoxidase protein (EC 1.11.1.)

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Sinorhizobium meliloti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium meliloti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL591790, CP001389
1 UniProt : C3MGX8
2 UniProt : Q92MX7, C3MGX8
2 Interpro : Q92MX7, C3MGX8
2 Pfam : Q92MX7, C3MGX8
2 PIRSF : Q92MX7, C3MGX8
2 SUPERFAM : Q92MX7, C3MGX8
Sequence
Graphical view for this peptide sequence: rhime-R02478
Colored MSA for Haloperoxidase (raw)
MTKSQVKTTTNDVSRREILAGAIGAATATAAAALSAASPAVAGGAEPPAG
AATPGATGSRIITRDGVEIYYKDWGPKGGPVVILSHGWPLSSDSWEAQAF
YLANNGFRVVTHDRRGHGRSSQPWDGNDMDHYADDLADLIETLDLKDIFL
AGFSTGGGEVARYIGRHGTARVAKAGLISAVPPLMVKTDDNPGGLPKEVF
DGLQAASLADRSQLYRDIASGPFFGFNRPGAKPSQGMIDSFWLQGMTAGH
KNAYDSIVAFSQTDFTEDLKKFDVPTLIIHGDDDQVVPIDAAARASKKLV
PQAELKVYPGAPHGITDTHKDQLNKDLLDFARS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKSQVKTTTNDVSRREILAGAIGAATATAAAALSAASPAVAGGAEPPAG
AATPGATGSRIITRDGVEIYYKDWGPKGGPVVILSHGWPLSSDSWEAQAF
YLANNGFRVVTHDRRGHGRSSQPWDGNDMDHYADDLADLIETLDLKDIFL
AGFSTGGGEVARYIGRHGTARVAKAGLISAVPPLMVKTDDNPGGLPKEVF
DGLQAASLADRSQLYRDIASGPFFGFNRPGAKPSQGMIDSFWLQGMTAGH
KNAYDSIVAFSQTDFTEDLKKFDVPTLIIHGDDDQVVPIDAAARASKKLV
PQAELKVYPGAPHGITDTHKDQLNKDLLDFARS


References
    Title: Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems
    Schmeisser C, Liesegang H, Krysciak D, Bakkou N, Le Quere A, Wollherr A, Heinemeyer I, Morgenstern B, Pommerening-Roser A and Streit WR <8 more author(s)>
    Ref: Applied Environmental Microbiology, 75:4035, 2009 : PubMed

            

    Title: Analysis of the chromosome sequence of the legume symbiont Sinorhizobium meliloti strain 1021
    Capela D, Barloy-Hubler F, Gouzy J, Bothe G, Ampe F, Batut J, Boistard P, Becker A, Boutry M and Galibert F <18 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 98:9877, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer