Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhime-R02260

Rhizobium meliloti (Sinorhizobium meliloti) Rhizobium sp., Sinorhizobium medicae, hypothetical protein r02260

Comment
Other strains: Rhizobium sp. (strain NGR234); Sinorhizobium medicae (strain WSM419) (Ensifer medicae)


Relationship
Family|Cocaine_esterase
Block| X
Position in NCBI Life Tree|Sinorhizobium meliloti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium meliloti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL591790
3 UniProt : Q92NE6, C3MET6, A6UBI7
3 UniProt : Q92NE6, C3MET6, A6UBI7
3 Interpro : Q92NE6, C3MET6, A6UBI7
3 Pfam : Q92NE6, C3MET6, A6UBI7
3 PIRSF : Q92NE6, C3MET6, A6UBI7
3 SUPERFAM : Q92NE6, C3MET6, A6UBI7
Sequence
Graphical view for this peptide sequence: rhime-R02260
Colored MSA for Cocaine_esterase (raw)
MAERNFTVIENEWITLEDGTRLAARIWMPEGTEQKPVPAVLEYLPYRKRD
GTCARDESTYPAFAAAGIAGVRVDIRGSGESEGVIDGEYTPRELSDGCEI
IEWIAAQPWSNGKVGMMGISWGGFNCLQVAALKPPALKAVISIASTVDRY
NDDIHYKNGCHLSAQLSWAATMLAYQSRSPDPELVGERWREMWLERLENE
PFFLEEWLEHQRRDDFWRHGSISEDFDGFPIPALMIAGWADGYRNTPIKA
VEGLGGKAKALIGPWVHKYPHFAWPKPRADFLGEAIRWWNRWLRDEKNDA
EQLPQMRAYILDGPRPAVRRNEDPGRWIAKDVWTTPEMRTFAVSSEGGLA
AGSPSRRGIGDVYLRSPLDTGTAAGEYFTLKPDAEMPGDQRIDDAGSLTF
DTHPLLEAEDYLGQPVLDLELSCSAETANLAARIVDVHPDGTSTRVAFGV
LNLAHRNGNAKPVPMEKNRKTRVTLVLDACGYRFRAGHRIRLSLSTSYWP
IILPSPTDPGVTIDTASVSLSLPLLGDHREIVVPQPANPDPLPHYIEHSP
AETRRTVERDMTKCRTHYRIYENTGLVEHPGTGNATQDIRDETWTIAPDD
PHSMTGVSTWTCIARRGQQSLKTVSTSRLGCTETEWITSAKVEAFEDETK
IFEKTFEKRIRRDFM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAERNFTVIENEWITLEDGTRLAARIWMPEGTEQKPVPAVLEYLPYRKRD
GTCARDESTYPAFAAAGIAGVRVDIRGSGESEGVIDGEYTPRELSDGCEI
IEWIAAQPWSNGKVGMMGISWGGFNCLQVAALKPPALKAVISIASTVDRY
NDDIHYKNGCHLSAQLSWAATMLAYQSRSPDPELVGERWREMWLERLENE
PFFLEEWLEHQRRDDFWRHGSISEDFDGFPIPALMIAGWADGYRNTPIKA
VEGLGGKAKALIGPWVHKYPHFAWPKPRADFLGEAIRWWNRWLRDEKNDA
EQLPQMRAYILDGPRPAVRRNEDPGRWIAKDVWTTPEMRTFAVSSEGGLA
AGSPSRRGIGDVYLRSPLDTGTAAGEYFTLKPDAEMPGDQRIDDAGSLTF
DTHPLLEAEDYLGQPVLDLELSCSAETANLAARIVDVHPDGTSTRVAFGV
LNLAHRNGNAKPVPMEKNRKTRVTLVLDACGYRFRAGHRIRLSLSTSYWP
IILPSPTDPGVTIDTASVSLSLPLLGDHREIVVPQPANPDPLPHYIEHSP
AETRRTVERDMTKCRTHYRIYENTGLVEHPGTGNATQDIRDETWTIAPDD
PHSMTGVSTWTCIARRGQQSLKTVSTSRLGCTETEWITSAKVEAFEDETK
IFEKTFEKRIRRDFM


References
    Title: Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems
    Schmeisser C, Liesegang H, Krysciak D, Bakkou N, Le Quere A, Wollherr A, Heinemeyer I, Morgenstern B, Pommerening-Roser A and Streit WR <8 more author(s)>
    Ref: Applied Environmental Microbiology, 75:4035, 2009 : PubMed

            

    Title: Analysis of the chromosome sequence of the legume symbiont Sinorhizobium meliloti strain 1021
    Capela D, Barloy-Hubler F, Gouzy J, Bothe G, Ampe F, Batut J, Boistard P, Becker A, Boutry M and Galibert F <18 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 98:9877, 2001 : PubMed

            

    Title: The composite genome of the legume symbiont Sinorhizobium meliloti
    Galibert F, Finan TM, Long SR, Puhler A, Abola P, Ampe F, Barloy-Hubler F, Barnett MJ, Becker A and Batut J <46 more author(s)>
    Ref: Science, 293:668, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer