Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: olean-d0vwz4

Oleispira antarctica cold-active and anion-activated carboxyl esterase OLEI01171 Esterase APC40077

Comment
close to sheon-SOA0048 but not found identical with genomic sequence may be a strain variant


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Oleispira antarctica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oceanospirillaceae: N E > Oleispira: N E > Oleispira antarctica: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 3I6Y, 3S8Y
No kinetic





No Substrate
No inhibitor
1 UniProt : D0VWZ4
2 Structure : 3S8Y, 3I6Y
1 UniProt : D0VWZ4
1 Interpro : D0VWZ4
1 Pfam : D0VWZ4
1 PIRSF : D0VWZ4
1 SUPERFAM : D0VWZ4
Sequence
Graphical view for this peptide sequence: olean-d0vwz4
Colored MSA for A85-EsteraseD-FGH (raw)
GMSIENLSSNKSFGGWHKQYSHVSNTLNCAMRFAIYLPPQASTGAKVPVL
YWLSGLTCSDENFMQKAGAQRLAAELGIAIVAPDTSPRGEGVADDEGYDL
GQGAGFYVNATQAPWNRHYQMYDYVVNELPELIESMFPVSDKRAIAGHSM
GGHGALTIALRNPERYQSVSAFSPINNPVNCPWGQKAFTAYLGKDTDTWR
EYDASLLMRAAKQYVPALVDQGEADNFLAEQLKPEVLEAAASSNNYPLEL
RSHEGYDHSYYFIASFIEDHLRFHSNYLNA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GMSIENLSSNKSFGGWHKQYSHVSNTLNCAMRFAIYLPPQASTGAKVPVL
YWLSGLTCSDENFMQKAGAQRLAAELGIAIVAPDTSPRGEGVADDEGYDL
GQGAGFYVNATQAPWNRHYQMYDYVVNELPELIESMFPVSDKRAIAGHSM
GGHGALTIALRNPERYQSVSAFSPINNPVNCPWGQKAFTAYLGKDTDTWR
EYDASLLMRAAKQYVPALVDQGEADNFLAEQLKPEVLEAAASSNNYPLEL
RSHEGYDHSYYFIASFIEDHLRFHSNYLNA


Reference
    Title: Structure and activity of the cold-active and anion-activated carboxyl esterase OLEI01171 from the oil-degrading marine bacterium Oleispira antarctica
    Lemak S, Tchigvintsev A, Petit P, Flick R, Singer AU, Brown G, Evdokimova E, Egorova O, Gonzalez CF and Yakunin AF <6 more author(s)>
    Ref: Biochemical Journal, 445:193, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer