Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lysen-a0a1j1ebl3

Lysobacter enzymogenes. Virulence protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Lysobacter enzymogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Lysobacter: N E > Lysobacter enzymogenes: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP014940
1 UniProt : A0A1J1EBL3
1 UniProt : A0A1J1EBL3
1 Interpro : A0A1J1EBL3
1 Pfam : A0A1J1EBL3
1 PIRSF : A0A1J1EBL3
1 SUPERFAM : A0A1J1EBL3
Sequence
Graphical view for this peptide sequence: lysen-a0a1j1ebl3
Colored MSA for VirJ (raw)
MCAAFAAPASAATAAAKPAAPAAATVTAGEITHGRFVRTPVRMPQGEVKR
FVLWFADGVDAAARKARVDALAADGAMVATVDLAALEAVLRKDGGQCNFS
SGDVENFSRYVQAYYRLPTYHLPLLVGDGEGAAFAYAIAAQGNAGLFAGA
ASLGFCPSLRAAQALCPSGSLKLRVEGKRAQLQPQPLQVPWLLAAPAGGK
AACAPAQAEAFAQAVPQARTFKRDARGDALPGLRAALVSLGAQRHASLPP
PPADLAGLPVNEMPAQAGGNADTFAVFVSGDGGWADVDKSVSKRLAEAGV
PVVGVDSLRYFWTPRTPQSFGADLDRIVRYYRAQWKRERVILVGFSQGAD
VLPGGYNQLPQATRELVRLTALLSPGQKAEYEFHLSNWIGSSGQGLPIAP
QVAKMPASQVLCIYGSEDGDALCPHLPAGGVRIEKMHGDHHVDGDYDGVA
ARVLAAAGIAAAAASAPPSP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCAAFAAPASAATAAAKPAAPAAATVTAGEITHGRFVRTPVRMPQGEVKR
FVLWFADGVDAAARKARVDALAADGAMVATVDLAALEAVLRKDGGQCNFS
SGDVENFSRYVQAYYRLPTYHLPLLVGDGEGAAFAYAIAAQGNAGLFAGA
ASLGFCPSLRAAQALCPSGSLKLRVEGKRAQLQPQPLQVPWLLAAPAGGK
AACAPAQAEAFAQAVPQARTFKRDARGDALPGLRAALVSLGAQRHASLPP
PPADLAGLPVNEMPAQAGGNADTFAVFVSGDGGWADVDKSVSKRLAEAGV
PVVGVDSLRYFWTPRTPQSFGADLDRIVRYYRAQWKRERVILVGFSQGAD
VLPGGYNQLPQATRELVRLTALLSPGQKAEYEFHLSNWIGSSGQGLPIAP
QVAKMPASQVLCIYGSEDGDALCPHLPAGGVRIEKMHGDHHVDGDYDGVA
ARVLAAAGIAAAAASAPPSP


Reference
    Title: Complete genome sequence and expression profile of the commercial lytic enzyme producer Lysobacter enzymogenes M497-1
    Takami H, Toyoda A, Uchiyama I, Itoh T, Takaki Y, Arai W, Nishi S, Kawai M, Shin-Ya K, Ikeda H
    Ref: DNA Research, 24:169, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer