Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klep7-menh

Klebsiella pneumoniae subsp. pneumoniae subsp. rhinoscleromatis Klebsiella sp. 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

Comment
Other strains; Klebsiella pneumoniae subsp. pneumoniae (strains ATCC700721/MG; NTUH-K2044; HS11286) subsp. rhinoscleromatis ATCC 13884 Klebsiella sp. 'MS 92-3; 4_1_44FAA)


Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: CP000647, AP006725, ACZD01000156
1 UniProt : A6TBV7
1 UniProt : A6TBV7
1 Interpro : A6TBV7
1 Pfam : A6TBV7
1 PIRSF : A6TBV7
1 SUPERFAM : A6TBV7
Sequence
Graphical view for this peptide sequence: klep7-menh
Colored MSA for MenH_SHCHC (raw)
MILSAAVDNGQPGYPWLVFLHGFSGDRNEWRKVGDAFPAWPRLYLDLPGH
GGSADIAVQDFAGVNTLLQSTLNSYNIHKYWLIGYSLGGRVAMNFASQPR
AGMRGLIVEGGHPGLQDAEARQARRSNDSAWAERFRREPLEQVFADWYQQ
PVFASLNAAQRESLVALRSRNNGATLAAMLQATSLAAQADLRASLQARDF
PFHYLCGERDAKFRAIAQTLAADLHLIHHAGHNAHRDNPAAVIACLAQIL
AS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILSAAVDNGQPGYPWLVFLHGFSGDRNEWRKVGDAFPAWPRLYLDLPGH
GGSADIAVQDFAGVNTLLQSTLNSYNIHKYWLIGYSLGGRVAMNFASQPR
AGMRGLIVEGGHPGLQDAEARQARRSNDSAWAERFRREPLEQVFADWYQQ
PVFASLNAAQRESLVALRSRNNGATLAAMLQATSLAAQADLRASLQARDF
PFHYLCGERDAKFRAIAQTLAADLHLIHHAGHNAHRDNPAAVIACLAQIL
AS


References
    Title: Complete genome sequence of Klebsiella pneumoniae subsp. pneumoniae HS11286, a multidrug-resistant strain isolated from human sputum
    Liu P, Li P, Jiang X, Bi D, Xie Y, Tai C, Deng Z, Rajakumar K, Ou HY
    Ref: Journal of Bacteriology, 194:1841, 2012 : PubMed

            

    Title: Complete genome sequence of the 2,3-butanediol-producing Klebsiella pneumoniae strain KCTC 2242
    Shin SH, Kim S, Kim JY, Lee S, Um Y, Oh MK, Kim YR, Lee J, Yang KS
    Ref: Journal of Bacteriology, 194:2736, 2012 : PubMed

            

    Title: Genome sequencing and comparative analysis of Klebsiella pneumoniae NTUH-K2044, a strain causing liver abscess and meningitis
    Wu KM, Li LH, Yan JJ, Tsao N, Liao TL, Tsai HC, Fung CP, Chen HJ, Liu YM and Tsai SF <10 more author(s)>
    Ref: Journal of Bacteriology, 191:4492, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer