Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: kitsk-e4n648

Kitasatospora setae (strain ATCC 33774 / DSM 43861 / JCM 3304 / KC A-0304 / NBRC 14216 / KM-6054) (Streptomyces setae) Putative uncharacterized protein

Comment
only c-term Pfam A Abhydrolase_8 308 481


Relationship
Family|Duf_1023
Block| X
Position in NCBI Life Tree|Kitasatospora setae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Kitasatospora: N E > Kitasatospora setae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP010968
1 UniProt : E4N648
1 UniProt : E4N648
1 Interpro : E4N648
1 Pfam : E4N648
1 PIRSF : E4N648
1 SUPERFAM : E4N648
Sequence
Graphical view for this peptide sequence: kitsk-e4n648
Colored MSA for Duf_1023 (raw)
GAPPGSGLTYEEWNREQRDLRALRERLDGRGGADRLFLLALDPRGDGRAV
VAAGDPDGADHTAVLVPGTATTLASVPGQVERIDRLRDAAAAQAGPGQRV
AVVSWLGYDAPEADASVLTAARAEEGAADLRRFTEGVRTARGGRPGHLTV
IGHSYGTTTVGAAAAGGAGLGADDIVAVASPGMTAARAADLHIDPAHVWA
GTAADDRVRLATGTTLGADPTGADFGGRTFGVDTSGHSGYWAAGSESLAN
QGRIIAGRTPATAADAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GAPPGSGLTYEEWNREQRDLRALRERLDGRGGADRLFLLALDPRGDGRAV
VAAGDPDGADHTAVLVPGTATTLASVPGQVERIDRLRDAAAAQAGPGQRV
AVVSWLGYDAPEADASVLTAARAEEGAADLRRFTEGVRTARGGRPGHLTV
IGHSYGTTTVGAAAAGGAGLGADDIVAVASPGMTAARAADLHIDPAHVWA
GTAADDRVRLATGTTLGADPTGADFGGRTFGVDTSGHSGYWAAGSESLAN
QGRIIAGRTPATAADAP


Reference
    Title: Genome sequence of Kitasatospora setae NBRC 14216T: an evolutionary snapshot of the family Streptomycetaceae
    Ichikawa N, Oguchi A, Ikeda H, Ishikawa J, Kitani S, Watanabe Y, Nakamura S, Katano Y, Kishi E and Fujita N <16 more author(s)>
    Ref: DNA Research, 17:393, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer