Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibf5-s0ea65

Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) Related to triacylglycerol lipase II

Comment
Other strains: Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Gibberella fujikuroi


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Gibberella fujikuroi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium fujikuroi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HF679029
1 UniProt : S0EA65
2 UniProt : S0EA65, A0A0I9X4I3
2 Interpro : S0EA65, A0A0I9X4I3
2 Pfam : S0EA65, A0A0I9X4I3
2 PIRSF : S0EA65, A0A0I9X4I3
2 SUPERFAM : S0EA65, A0A0I9X4I3
Sequence
Graphical view for this peptide sequence: gibf5-s0ea65
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MCRTCTSRRQSGRQRIDLLALGPRDEPVGSDVQTSEVLLSDWLCSSTTAP
RVNLGYAKYEGVALSSGVNQFLGMRYAAPPTGSRRFRLPDRPLNETYLVQ
AHKHGAVCYGVNPSVPTPDLEFSEDCLFIDVYAPKNATSNKDGGLPVMLW
IQGGGFVQNINANYNGSGLIEATQGNMIVATFNYRVGPYGFLANHELEEE
GNLNVGLHDQMAAIEWIHEHISKFGGDPSKVTLFGTSVGGGSVLLQLLAY
GGNSTNSSKQWSAGIAESMYLPSVYTVDEMQFHYEHLLTATNCSDLECLR
QLPIEQFQAKNVAIPFPGQHEPALFGYGPTIDGSFLPDRPSTLLRQGRFA
KDKSMILGSSNTEGTVFAPQANTTEDVNQFLTAQLPGLTETALNRLNQLY
SDIPATYPNVNITQAPLYYRAAGMLGDSSFLCPAFQFAAGLQHAGVPVYL
YLDRIFDPVEVQAGYIVPHTFDTQAVWGPSYSINYAALPGARSYEPGQSN
AAIVPVVQAFWTSFARSSGNPNILRANGTLFWKESMGGSFLSIETNNTRM
EQISNSLSEKCAYWADLEAETRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCRTCTSRRQSGRQRIDLLALGPRDEPVGSDVQTSEVLLSDWLCSSTTAP
RVNLGYAKYEGVALSSGVNQFLGMRYAAPPTGSRRFRLPDRPLNETYLVQ
AHKHGAVCYGVNPSVPTPDLEFSEDCLFIDVYAPKNATSNKDGGLPVMLW
IQGGGFVQNINANYNGSGLIEATQGNMIVATFNYRVGPYGFLANHELEEE
GNLNVGLHDQMAAIEWIHEHISKFGGDPSKVTLFGTSVGGGSVLLQLLAY
GGNSTNSSKQWSAGIAESMYLPSVYTVDEMQFHYEHLLTATNCSDLECLR
QLPIEQFQAKNVAIPFPGQHEPALFGYGPTIDGSFLPDRPSTLLRQGRFA
KDKSMILGSSNTEGTVFAPQANTTEDVNQFLTAQLPGLTETALNRLNQLY
SDIPATYPNVNITQAPLYYRAAGMLGDSSFLCPAFQFAAGLQHAGVPVYL
YLDRIFDPVEVQAGYIVPHTFDTQAVWGPSYSINYAALPGARSYEPGQSN
AAIVPVVQAFWTSFARSSGNPNILRANGTLFWKESMGGSFLSIETNNTRM
EQISNSLSEKCAYWADLEAETRQ


Reference
    Title: Deciphering the cryptic genome: genome-wide analyses of the rice pathogen Fusarium fujikuroi reveal complex regulation of secondary metabolism and novel metabolites
    Wiemann P, Sieber CM, von Bargen KW, Studt L, Niehaus EM, Espino JJ, Huss K, Michielse CB, Albermann S and Tudzynski B <18 more author(s)>
    Ref: PLoS Pathog, 9:e1003475, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer