Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ascsu-f1ky57

Ascaris suum (Pig roundworm) (Ascaris lumbricoides) Carboxylesterase 2

Relationship
Family|OtherNon-catalytic_C
Block| C
Position in NCBI Life Tree|Ascaris suum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Ascaridida: N E > Ascaridoidea: N E > Ascarididae: N E > Ascaris: N E > Ascaris suum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JI167876, AEUI02000186
1 UniProt : F1KY57
1 UniProt : F1KY57
1 Interpro : F1KY57
1 Pfam : F1KY57
1 PIRSF : F1KY57
1 SUPERFAM : F1KY57
Sequence
Graphical view for this peptide sequence: ascsu-f1ky57
Colored MSA for OtherNon-catalytic_C (raw)
MMKNWFCVVYIFHISVCLASAQTTDNELIRVLSTGSLLKGAKIIVNDNST
IHLYLGIPYAESPADQNRYKAPIKRAKWDGILDASYYKVSCLYDSPDFEV
TLSTRFMSEDCLHVSVISSESCIQNGRCPVAVYLHGSNFNYASSSVIPVE
DIARRWATNDIIVVTTNFRLGSFGFLNLGEKTTAVNNAGLLDQLEALRWV
QREISRFGGDARRVTLMGFGSGAINADLLAISPTARGLFQQVVIIGGAAG
TMPNINEDWNVAASRSLAIESGCTTRFTWDTTNKEDIVNCLRGRQASELL
SVQRMLENTSRLYAFNLPAVDAREATPIIPNSVSTLSKMRRGYTMMIGSI
SNSMNWPNNAIKLDLFVPTRKMLKAMCGVAMLHRHFNFTVKLVKACQREY
STVSLGSKLVEDVAVFLPIYDSASANTRNGGTTFLFDYLSDDKEESLLAF
APSNSANITQSDYVGTAISLFIKTGDPSSEALKWQPFEEERNNFVALTAA
ALPMNVNEYHFEAVNFWTIMAPQIAEKAEWLKENGTNILNDLVEAGKEGI
ASFAEAIGSIRDKRRKAIIEAIGKIASALGSIEEEIAKQKEAAVSKGIGW
IQGHIIVADILVEVNNLLDGVLADVCEKSVDSAVMTTAKSGEEGMNSIEP
ALRASIVGSVARSAVSNGDAEMVTIETADDYWGTWTNGAWFWIIHAAAVV
IVVALVAALATNCCSRKSGRSYEILA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKNWFCVVYIFHISVCLASAQTTDNELIRVLSTGSLLKGAKIIVNDNST
IHLYLGIPYAESPADQNRYKAPIKRAKWDGILDASYYKVSCLYDSPDFEV
TLSTRFMSEDCLHVSVISSESCIQNGRCPVAVYLHGSNFNYASSSVIPVE
DIARRWATNDIIVVTTNFRLGSFGFLNLGEKTTAVNNAGLLDQLEALRWV
QREISRFGGDARRVTLMGFGSGAINADLLAISPTARGLFQQVVIIGGAAG
TMPNINEDWNVAASRSLAIESGCTTRFTWDTTNKEDIVNCLRGRQASELL
SVQRMLENTSRLYAFNLPAVDAREATPIIPNSVSTLSKMRRGYTMMIGSI
SNSMNWPNNAIKLDLFVPTRKMLKAMCGVAMLHRHFNFTVKLVKACQREY
STVSLGSKLVEDVAVFLPIYDSASANTRNGGTTFLFDYLSDDKEESLLAF
APSNSANITQSDYVGTAISLFIKTGDPSSEALKWQPFEEERNNFVALTAA
ALPMNVNEYHFEAVNFWTIMAPQIAEKAEWLKENGTNILNDLVEAGKEGI
ASFAEAIGSIRDKRRKAIIEAIGKIASALGSIEEEIAKQKEAAVSKGIGW
IQGHIIVADILVEVNNLLDGVLADVCEKSVDSAVMTTAKSGEEGMNSIEP
ALRASIVGSVARSAVSNGDAEMVTIETADDYWGTWTNGAWFWIIHAAAVV
IVVALVAALATNCCSRKSGRSYEILA


References
    Title: Silencing of germline-expressed genes by DNA elimination in somatic cells
    Wang J, Mitreva M, Berriman M, Thorne A, Magrini V, Koutsovoulos G, Kumar S, Blaxter ML, Davis RE
    Ref: Dev Cell, 23:1072, 2012 : PubMed

            

    Title: Deep small RNA sequencing from the nematode Ascaris reveals conservation, functional diversification, and novel developmental profiles
    Wang J, Czech B, Crunk A, Wallace A, Mitreva M, Hannon GJ, Davis RE
    Ref: Genome Res, 21:1462, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer