Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT2G42690

Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Phospholipase A1-IIdelta DAD1-like PLA20

Comment
Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine (PC) at the sn-1 position. High activity toward PC, medium activity toward monogalactosyldiacylglycerol (MGDG) and low activity toward triacylglycerol (TAG). Confers sensitivity to UV-B radiation probably by deesterifying membrane phospholipids


Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC006931
2 UniProt : Q9SJI7, D7LJB9
2 UniProt : Q9SJI7, D7LJB9
2 Interpro : Q9SJI7, D7LJB9
2 Pfam : Q9SJI7, D7LJB9
2 PIRSF : Q9SJI7, D7LJB9
2 SUPERFAM : Q9SJI7, D7LJB9
1 Tair database : AT2G42690
Sequence
Graphical view for this peptide sequence: arath-AT2G42690
Colored MSA for Plant_phospholipase (raw)
MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQ
NSKYCGASRYGKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQ
SRDSWDRESNWFGYIAVTSDERSKALGRREIYIALRGTSRNYEWVNVLGA
RPTSADPLLHGPEQDGSGGVVEGTTFDSDSEDEEGCKVMLGWLTIYTSNH
PESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLGATEAVLAAYD
IAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHKNLKILHVRNTIDLLT
RYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNG
KKGEFKLMVKRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWV
LAPVEEEPVPEF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQ
NSKYCGASRYGKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQ
SRDSWDRESNWFGYIAVTSDERSKALGRREIYIALRGTSRNYEWVNVLGA
RPTSADPLLHGPEQDGSGGVVEGTTFDSDSEDEEGCKVMLGWLTIYTSNH
PESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLGATEAVLAAYD
IAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHKNLKILHVRNTIDLLT
RYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNG
KKGEFKLMVKRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWV
LAPVEEEPVPEF


References
6 more
    Title: Acylated monogalactosyl diacylglycerol: prevalence in the plant kingdom and identification of an enzyme catalyzing galactolipid head group acylation in Arabidopsis thaliana
    Nilsson AK, Johansson ON, Fahlberg P, Kommuri M, Topel M, Bodin LJ, Sikora P, Modarres M, Ekengren S and Andersson MX <4 more author(s)>
    Ref: Plant J, 84:1152, 2015 : PubMed

            

    Title: Wound-induced expression of DEFECTIVE IN ANTHER DEHISCENCE1 and DAD1-like lipase genes is mediated by both CORONATINE INSENSITIVE1-dependent and independent pathways in Arabidopsis thaliana
    Rudus I, Terai H, Shimizu T, Kojima H, Hattori K, Nishimori Y, Tsukagoshi H, Kamiya Y, Seo M and Ishiguro S <2 more author(s)>
    Ref: Plant Cell Rep, 33:849, 2014 : PubMed

            

    Title: Phospholipid-derived signaling mediated by phospholipase A in plants
    Ryu SB
    Ref: Trends Plant Sci, 9:229, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer