Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Thioesterase_acyl-transferase

Thioesterase_acyl-transferase


Genes:Proteins in Thioesterase_acyl-transferase (17)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
vibha-1luxd: Vibrio harveyi, Vibrio orientalis, Vibrio vulnificus, Vibrio chagasii myristoyl-ACP-specific thioesterase acyl transferase (luxD) gene, 5 reference(s), 1 structure(s).e.g. 1THTVibrio harveyi Show
MNNQCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDH
FAGLAEYLSENGFHVFRYDSLHHVGLSSGSIDEFTMTTGKNSLCTVYHWL
QTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALG
FDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTS
VPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVL
RNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIESR
TPEMA
9bact-d8pbw6: Candidatus Nitrospira defluvii Putative uncharacterized protein, 1 reference(s)Candidatus Nitrospira defluvii Show
VVLAPGYGESKRDYVPLAYYLAGNGFHVVRFDNVNHVGESDGLVTQFRLE
DMETDLETVLDYVAAQWPGRSIGLVATSLAGRVALKVAGRVPHLGLLALI
NGIMDVQHTLQAVHQEDLIGEHLAGARKGVVNILGLTIDADRWLEHAVQG
GYADLRSTEQDAERLHAPVVLFHAEQDAWVDPSSIEAVGAAMGENLRHSY
VVPGALHRLQESPRKARTVYRQIALCCQEELWPARSMARTVEPSHREIGV
QNRAERERSKK
9bact-d8pdl3: Candidatus Nitrospira defluvii Putative uncharacterized protein, 1 reference(s)Candidatus Nitrospira defluvii Show
HDVPTRTDSTQYPLVLLCPGYGTTQQAYVALAYTLAACGLQILRYDHSRH
IGLSDGDPTQTTLTSLEDDLDTVLSFAQKEFPGIPLTVLAPDLLGRIVLR
RQDWHRRVNRLLLLNPALDIRNCLTSLHQRDLVGEHLAGTRLGLGNLMGI
PLDIDHFVADAVTGRYTENTALQEDLSHCGTDVVFLT
9delt-a6g1j0: Plesiocystis pacifica SIR-1 LuxD. acyl transferasePlesiocystis pacifica SIR-1 Show
MSTEESVLRLEDGRQIVIWHSRPQSEEPVRGTVLLAPGFCARMYSLAAMA
AYLCANGFAVYRYDPLDHRGPSSGELADFTMTTGRYSMDQVLDWLARERG
VESLGVIATSLSARIAYRVASERDNVAYLVTAVGVTHLRATLERVFGVDH
MASPPEQLPETVVFEERHHIRTLGFATDAHELGWNPAETTRAELDRASVP
IVAFIARDDDWVLESEVEEALDLANHPERRMCKLEGSGHNLAKNPRIAQA
MLRELTGAVMALETGGEWLRAGLPPSFPAIEREPTFEMLTAQVIAERRRS
VR
9gamm-q4a538: Vibrio salmonicida Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) luxd, 1 reference(s)Vibrio salmonicida Show
MDHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGDINEFSMSIGKDSLLTVI
DWLKGRNIEKLGLIAASLSARIAYEIANEIDLSFLVTAVGVVNLRDTLER
ALKYDYLQLPIEKLPEDLDFEGHNLGSEVFVTDCFKHKWDTLDSTINKMK
NLDVPFIAFTANDDNWVKQSEVLDLLISLNSEKCKLYSLIGSSHDLGENL
VVLRNFYQSVTKAAIALDNDSLDLDVNMTEPRFEDITSVTVKERRLKNQI
ENESLELV
corad-d5ene2: Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 2319 / KCTC 12865) Methyltransferase type 11, 1 reference(s)Coraliomargarita akajimensis Show
MAVSTQIRGKLSIQSEVVVFPSRNGKRLVGFIDRQQECGDDGDWVILTPK
FGESKKNSLQVAYQLAANGLRVLRFDHSNHIGESAGSIVDYSFSDAIADI
QGAYDYLEAAFGSPRAQLVANSLSGRCALRVAAIDPRVTRLVLMVGVVNF
RQTATEVYQRDMVAEYQQGQLQGVSDILGHQVNVDAFLKDCIEQDMHDLG
GSLQDVKRLNCEVFLFCAEQDVWVEMNDIVQLRDASDRVRLYRIPDAMHE
LRENPDAAQQANGALIYLCSRGVLPEGAAFSVAHPLKRELMGQNKIERER
LRAAAPLKGSENDFWQRYLEKYNVLESVGDFRDYLDLLGQCLGPIRAGQV
YFDCGCGNGL
phole-lxd1: Photobacterium leiognathi subsp. leiognathi Photobacterium mondopomensis Photobacterium damselae thioesterase (c14acp-te), 6 reference(s)Photobacterium leiognathi Show
MENTQHSLPIDHVIDIGDNRYIRVWETKPKNKETKRNNTIVIASGFARRM
DHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFSMSVGKHSLLTVID
WLKERNINNIGLIASSLSARIAYEVAAEIDLSFLITAVGVVNLRSTLEKA
LKYDYLQMEVNTIPEDLIFEGHNLGSKVFVTDCFENNWDSLDSTINKICE
LDIPFIAFTSDGDDWVCQHEVKHLVSNVKSDKKKIYSLVGSSHDLGENLV
VLRNFYQSMTKAAVSLDRQLVELVDEIIEPNFEDLTVITVNERRLKNKIE
NEIINRLADRVLASV
phole-lxd2: Photobacterium leiognathi Photobacterium mondopomensis thioesterase (c14acp-te), 5 reference(s)Photobacterium leiognathi Show
MKNTQTSAPIDHMISLGDNRHIRVWETLPKNQEIKRNNTIVIAAGFARRM
DHFAGLAEYLANNGFHVIRYDSLNHVGLSSGEINQFSMSVGKHSLLTVIE
WLKGRGIDQIGLIASSLSARIAYDVAAEINLSFLITAVGVVNLRSTLEKA
LKYDYLQMEINDIPEDLDFEGYNLGSKVFVTDCFDNNWDSLDSTINKTKD
LDIPFIAFISNGDDWVCQQEVKKLVGNMNSDKTKIYSLIGSSHDLGENLI
VLRNFYQSVTRAAIRVDSEVIDLVDDISEPNFEDLTIITVNERRLKNKIA
KRNVR
pholu-LUXD2: Photorhabdus luminescens (Xenorhabdus luminescens) and (subsp. laumondii) acyl transferase, 1 reference(s)Photorhabdus luminescens Show
MENKSKYKTIDHVLCVEGNKKIHVWETLPEETSPKRKNPIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNRGILASSLSARIVYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLTSTINSMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIHSLLGSSHDLCVFLV
VLRNFYQSVTKAAIAMDNDRLDIDVDIIEPSFEHLTIATVNERRMKIEIE
NQAISLS
pholu-lxd1: Photorhabdus luminescens (Xenorhabdus luminescens) thioesterase, 6 reference(s)Photorhabdus luminescens Show
MENESKYKTIDHVICVEGNKKIHVWETLPEENSPKRKNAIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLTTRKINNFGMLASSLSARIAYASLSEINASFLITAVGFVNLRYSLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLASTINNMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIYSLLGSSHDLSENLV
VLRNFYQSVTKAAIAMDNDHLDIDVDITEPSFEHLTIATVNERRMRIEIE
NQAISLS
pholu-lxd2: Photorhabdus luminescens (Xenorhabdus luminescens), Photorhabdus asymbiotica, thioesterase (c14acp-te), 3 reference(s)Photorhabdus luminescens Show
MENKSRYKTIDHVICVEENRKIHVWETLPKENSPKRKNTLIIASGFARRM
DHFAGLAEYLSQNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNLGMLASSLSARIAYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPIDELPDNLDFEGHKLGAEVFARDCFDSGWEDLTSTINSMMH
LDIPFIAFTANNDDWVKQDEVITLLSSIRSHQCKIYSLLGSSHDLGENLV
VLRNFYQSVTKAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIE
NQVISLS
phopo-luxd: Photobacterium phosphoreum Photobacterium kishitanii, thioesterase, 7 reference(s)Photobacterium phosphoreum Show
MKSENNSVPIDHVIKVDNERHIRVWETFPKNQCDKRNNTIVIASGFARRM
DHFAGLAEYLSTNGFHVIRYDSLNHVGLSSGEIDQFSMSVGKKSLLTVID
WLKSEHGIDQVGLIASSLSARIAYDIVADVNLSFLITAVGVVNLRNTLEQ
ALKYDYLQMEIDEIPEDLDFDGYNLGSKVFVTDCFENNWDTLDSTINKTK
NLNVPFIAFVANDDSWVQQHEVEELMSNINSDKTKIYSLIGSSHDLGENL
IVLRNFYQSITKAAIALDSNLVGLVSEIIEPQFEALTIATVNERRLKNKI
QSKSLA
sheha-LUXD: Shewanella hanedai (Alteromonas hanedai) myristoryl-acp thioesterase (c14acp-te), 1 reference(s)Shewanella hanedai Show
MECSNSCLTIDHVIQLDDDKEIRVWETLPKDNTAVRNNTILIASGFARRM
DHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGDINEFTMSIGKDSLLIVIE
WLKGRGVNKLGLIAASLSARIAYEISNDVDLSFLVTAVGVVNLRDTLERS
LKYDYLQLEIEDLPEDLDFEGHNLGSKVFVRDCFKHNWVTLDSTKNKMKN
LDIPFIAFTANDDDWVKKAEVLEMMNSISSTKCKLYSLIGSSHDLGENLV
VLRNFYQSVTKAAISLDNDSVDLNVEIFEPKFEELTSVTVQERRLKNKIE
SEILELMN
shewm-luxd: Shewanella woodyi (and strain ATCC 51908 / MS32) Myristoyl-ACP-specific thioesteraseShewanella woodyi Show
MTNEDTFSTIDHAINLETGKTIRVWETFPKDNSLVKNNTILIASGFARRM
DHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGNINEFSMTIGKKSLLTVIE
WLKRRNINKFGLIAASLSARIAYDVANEIDLSFLVTAVGVVNLRDTLERA
LKYDYLQLPIEELPEDLDFEGHNLGSEIFVTDCFKHQWDTFNSTKNKMKD
LNIPFIAFTANDDSWVKQNEVLELIESLNPEKCQLYSLIGSSHDLGENLV
VLRNFYQSVTKAAIALDKGSLNLDINIIEPKFEDITSVTVKERRLKHNIE
SLELA
vibcl-q5ek34: Vibrio cholerae (strains bv. albensis; VL426; RC385) Vibrio sp. RC586 putative acyltransferase (fragment) luxD, 2 reference(s)Vibrio cholerae Show
TIDHVISLSGNQQIHVWETPPTLKFNSMPTRRNSILIASGFARRMDHFAG
LARYLSANGFHVYRYDSLHHVGLSSGTIDQYTMSIGKQSLEIVMAWLHNR
GVTDIGVIAASLSARIAYASVNELDLSFLITAVGVVNLRDTLEKALGFDY
LSLPIQALPNDLDFEGHKLGAEVFVRDCFANHWDSFSSTVEQIRHLSIPF
IAFTANGDDWVKQDEVIEMLSHIPRGQSKLYSLLGSSHDLGENLVVLRNF
YQSVTKAAIALDSNSFDINIPFVEPTFEQLTIATVNERRMKNQIETETMM
QA
vibf1-q5dz04: Vibrio fischeri (strain ATCC 700601 / ES114) luxd. acyl transferase (EC 2.3.1.-), 1 reference(s)Vibrio fischeri Show
MKDESSFFTIDHIIELENGQSIRVWETPPKSDTHKKNSTIVIAAGFARRM
DHFAGLAEYLSSNGFRVIRYDSLHHVGLSSGQIDEFSMSIGKHSLLIVVG
WLRAKGIQNLGIIAASLSARIAYEVINDIDASFLITAVGVVNLQDTLEKA
LKYDYLRLPIDELPDDLDFEGHNLGSKVFVTDCLKNEWDTLGSTFKAVQG
LNIPFIAFTANGDSWVNQSDVEKMIDNIDTTQCKLYSLIGSSHDLGENLV
VLRNFYESVTRAAVALDKGSLDLDIEIVEPGFEDLTSTTVKERRLRNKIE
NELLELA
vibfi-LUXD: Vibrio fischeri (and strain MJ11) acyl-transferase luxd (c14acp-te), 2 reference(s)Vibrio fischeri Show
MKDESAFFTIDHIIKLDNGQSIRVWETLPKKNVPEKKHTILIASGFARRM
DHFAGLAEYLSTNGFHVIRYDSLHHVGLSSGCINEFTMSIGKNSLLTVVD
WLTDHGVERIGLIAASLSARIAYEVVNKIKLSFLITAVGVVNLRDTLEKA
LEYDYLQLPISELPEDLDFEGHNLGSEVFVTDCFKHNWDTLDSTLNSVKG
LAIPFIAFTANDDSWVKQSEVIELIDSIESSNCKLYSLIGSSHDLGENLV
VLRNFYQSVTKAALALDDGLLDLEIDIIEPRFEDVTSITVKERRLKNEIE
NELLELA
Sequences



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer