Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: A85-Est-Putative

A85-Est-Putative


Genes:Proteins in A85-Est-Putative (96)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
acic1-a0lsy0: Acidothermus cellulolyticus (strain ATCC 43068 / 11B) Putative esteraseAcidothermus cellulolyticus Show
MNLSVISVGFVTGLAVVTATAWLGAVLIACRRRFGFAAATALVAAVLTVV
TAADVVNAYYEYRPTIADVFGLARWTTLSSRQVALLTAPPSPSSSLAARE
PNAAAAGRPRHAVLPVGQATRRAVAARGAVTSVAVTDGQTSFPVGRVLVY
LPPQYFTDPTARFPTVYLLHGSPGEPADWLRSADAFHVGAELAGAGHPLI
LVFPPVGRSWSDDSECVDGAHEAVETYLIQHVVPTIDARFRTIPSRNDRS
IGGLSAGGFCALNLGLRHRDLFSAVLDFSGYTHPTHQGGMAALFGHRPDL
AAVVAANSPDRYAADLPALPPTRVFFACGAEEGGIAAAMRAMAATLGARG
IPATMQRFPGGHTFAVWRPALAAALDWLTGVEETSTAPAIARPVV
9acto-a7b9i8: Actinomyces odontolyticus ATCC 17982 Putative uncharacterized proteinActinomyces odontolyticus ATCC 17982 Show
MSVLGSIPLTSIKTLVAVAVLAVLSLLAGASLLARSAPSRCPGRTRRWLG
RAVILLVPTFLIASAGALVFNRSLGLVKTSGDLAKLALLSVVGTTAQSGG
EADVNAQSAAVSELDATFTKTEDGMLQTTWTGPSSGITQPVFVITPRDYS
PNDGKTYAVIELLHGYPGGPDGTMQGAQVQEALNNAIDEGIIPPTIIVGP
SLNVDEEAHDCADIEGRPAVYTWVSHDVPAMIRHNFPNTTSNRDAWMIGG
FSAGAYCAIWTALRTPETYGAAASLSGYDTQIEGHMTNQGEQYLADNTLS
TMLANRTPDGMRIYAMAAGDDAVGGAYTALKMASAVKEPDSVTTDVPPSG
GHAGPLWREHIPTMLAWWG
9acto-d0wnv3: Actinomyces sp. oral taxon 848 str. F0332 Esterase family proteinActinomyces sp. oral taxon 848 str. F0332 Show
MLGPDKLLTLIVFAIFTVASAATAVWLIGREPTRKIRAQASAAMVAAIVG
AISMTGIQMNRTLGYAASWSDVPGLFFMKPDGKGPTKPIRRPVPGPDAGD
PELSGHRGDSRWKAKFTKDSNGAYQTKFRGPISGINLPVWVWTPKNYSPT
NGKIYKVMLMLHGYPGNPYKVPTQLNLQNAMKKHPNTIMAIPSLKVDATS
PDCVDIKGRPAVGSWVVDDIVGMIRHNFPNTEKTRKGWTIAGASYGAYCS
AVLGLTHPQTFSKIISFSGYDQPETGRLLGAPPRVRREFSVSNLLTKQRA
WPQRFYVTGSKGDPKSAAFVQKLKRLSTPTVRITSLLQPIGGHNWGVWRK
ELPAALAWNGKG
9acto-d0wpr3: Actinomyces sp. oral taxon 848 str. F0332 Esterase family proteinActinomyces sp. oral taxon 848 str. F0332 Show
MAFFALTSASLLWTVIALTVVCFVWTVFGVPRKRWSGARAYAQQALGVAL
STLLFFSSAFLAFNRFSIWYSDWSDLLGYASDRGTTTQYGGGAALATPQA
KATTTPSNGASNSRKFTELQRKPLTNSALSGVSAKAPNGQWITAKIPGQG
SDADAWARVWLPPSYMDNPNKAYTVIMAFPGVPGSPKGYESPLHTDADLA
AAIKSGKIRDSIIVSPNVFPHDADTECMDVQGKGIETWVTKNVVPWVKTN
LRAEGGPDAWATYGYSAGAWCANMFAVRHPDLFRTSISMSGYYSPLFPSG
ESNQEGYVLADEVARNRPPVRIWNLSGAGDGKFRKSFDAFAPKVASPTSL
TSVEVKGSSHKWDAWTSAQPKALEWLGANAPAFRPQSGSTSPQSGSTTKA
PPVNASTPTPAPSTKTRAPAFGPEAAKPQLEPRIREPRVENGPR
9acto-c0w802: Actinomyces urogenitalis DSM 15434 Putative uncharacterized proteinActinomyces urogenitalis DSM 15434 Show
MRETLITTLAGEPRALAPQALTHVSLVSTSLVHTVFLAAVVAVVLTGVLV
AVRVRPGQRRAPRALLVSTVAALVLSQVLVLAAVGLRVNASLGFVQTVGD
LAAVASSRDSQTEAQLAPVGAASAQDGPTQPPAEFTPAQDGFVKASVTGA
RSGVTQEVWVWTPQGYSTTDQRSYPVIVFLYGDPGSASGTVDTLKASQAM
QAAIDSGALPPAIFVIPDLNADEQQKSSPDCADIVGHAKIGTWIQDDVPA
VVRASFPNVSKDRHQWALAGLSSGGYCAGWTAIMRSDVYSSAIMMSGYDV
PVLGGMSTSAELRRENTLSTLITHHAHQPLDLWVLGAQDDHDSAEVARNL
RETAPSSDSVEITTPSSGGHSWTLWSSHLPQALTWWGQKMGVASASSAAG
actmd-c6w9s6: Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMR3971) Putative esterase, 1 reference(s)Actinosynnema mirum Show
MLDWSLLPGARLAVAVVVAGAVALVALLLGRARRWWSRRVPLAVGVALAL
TGVAWAVVTLSRLTAYPLPPVVWGSVLAGSLALALAGVRLAARPWRWRRL
VALPLALVVLLGAGQAVNAHFGQYPTPRSALGLPRADEVDLAEVPPVDDG
VVPAPEGASVASAWTPPADLPKQGVVAQVTIPGTVSGLAARPGWVWLPPA
YLVVPRPLLPVLVLVNGQPGAPGDWLAGGRLAERMNAYAAEHAGLAPVVV
VPDDLGGSSVGNPMCLDSALGNARTYLVRDVPDWITSTLRVDPDPAAWAF
GGFSHGGTCAVQMAVTATDRYPTFLSISGEDEPRRGTRQQTVADAFGGDE
AAFRAVNPRDVLAGARFPQVAGRFVVGEGDRDFRAQGERMFAAARDAGMD
VELVVLPGQHGWEVWGPGLTRWLPWLGDRLRLTR
anavt-q3m877: Anabaena variabilis (strain ATCC 29413 / PCC 7937) putative esterase precursorAnabaena variabilis Show
MNQQKSSIFLLLSVLSLIGCNYWPISTAQVPTKTAAKLLSQANTDILATP
LTYQIETYKSQVMGGNRTYGVSLPPGYAQNSQQRYPVIFLLHGGHGEPIT
WFDKDRGEALKTLEKLYTTGKLQPSIIITPDGNDQRGSSPYWDPEYIDGS
NGKVSTAVGNELVKVVKSRYRTLPNPHFWAMGGLSSGGWGAVNIGLHNLN
NFSILFSHSGYFRDKSGPFNSPITFIKDVPTQAKKRLRIYLDTGSSDIDE
VKEGEKFSQELARLNIYHVFRQFPGSHTWQYWREHLTNSLTFVGEQFKAA
QAASKDKNLRHD
anavt-q3m878: Anabaena variabilis (strain ATCC 29413 / PCC 7937) putative esterase precursorAnabaena variabilis Show
MKIPKFFMGIVGAIAILSATGYYYVFILGAPQLDPPQEEANTGLKFQLET
FNSQAMGTVRNYGVILPPGYDKNLQKRYPVIFLLHGGHDDARAYVDKYAI
LNILAELYKSKKLPLSIVITPDGNDNRGSSPLYDPDYFDGANGKVGTLIG
SELVQVVKSRYRTLESPQFWALGGLSSGGWGALNIGLRYLNNFHIFFSHS
GYFTDNSGPQNSPQQIVQQLSPEDKKRLHIYLDAGVNDTNLLASTKVFHQ
TLNKLGIANVFYSFPGGHGLSGADIGWNYFHKHLKDSLTYVGEQFNNSTR
K
artat-a1r4v1: Arthrobacter aurescens (strain TC1) Esterase family protein, 1 reference(s)Arthrobacter aurescens Show
MNELLKLEISGPLVMTIAGVIGAGFFLLLFLRPSARWALTAITAIVVAAL
FGWLTVWIVEDVLDVFHVGLTPRVWFWAISCFAALGLAVVSFRHSPRWRK
VVAAVSVPVFLLVAALGINTEFGLNKTLGSALGISTEDAIQLAKPDPDAS
SPAGPLWQSWKPPADQPSKGEAGTQVIPATASGFNARPAGIYLPPAALAA
HPPKLPLFVLMMGQPGLPDPQYVSAALDEFAAKNNGLAPIAIVADQIGPD
QDDTLCLDTAKYGNVEKYINEDVVNWAKANLNILPDREHWTIAGYSNGGQ
CAISFAVKYPEMWGNVVDISGEEFPGAEDPAGNLAAIFNGNQAAYDAQKP
INIMKGKQFPNTTAVFTVGSDDTTYVAAAKAVSAAARNAGMTVTYYEVPN
GGHVGLALNAGLTKGFEVLYPRLGLSR
artat-a1r7v1: Arthrobacter aurescens (strain TC1) Putative esterase family protein, 1 reference(s)Arthrobacter aurescens Show
MDFLSDVSLVDGPFLWFSIACGAAGGAYLLWRRRRSWLLLVLASLVVSIG
AVALIHWVLVDLTATFSENLPFETLAWAVPAVAAVLLCAARFPQSSWRGR
SLSVAAVLGVVLLCVVQINLYFGLNNTVSDLLGTAVARIQPLEASLKRAA
DAKPGPALSAWKAPDSMPRNGIMRKAGIPGTASGFTAREAYIYLPPAYQT
VPRPSLPVLVLFAGQPGGPADWLSGGQLRTLLDKFAEAHQGIAPVTVVVD
PNGSANANTMCMDSNIASVDTYLSQDVPAWITETLNVSKDHKQWAVGGFS
FGGTCAMQMGTSHPDVYASILPFAAEREPALAKDRNKTISDSFDGDVEAF
ESRTPLVLMEQRNFAGSGVYLVSGEADREFTDYMHELADAARNAGFETEE
HAIPHAGHSWDAVIRGMPGGLDFLAARWGLPR
artca-b8hay6: Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 JCM 12360) Putative esteraseArthrobacter chlorophenolicus Show
MDWIFDVRLTDGPLYWAALILGLAGAAFLLIPPPPHGPLRWLSRVITAVA
LAFALVATVHWALINLYSVFPENIPDPVLLWLVPAVAAVLLWLFLLPRNS
WRRRGGGLAAALLVIALSSVQINAYFGLNRTVSDLMGTALARIPALEQNL
VRRAGDPDGVALQGWRPQGDIPDGGVLRKAAIPGTVSGMETRDAFIYFPP
AYFAQNRPALPVLVLIAGQPGGPADWLTGGALRGHMDSYAAAHGGVAPVV
VVPDANGSQNANTMCMDSQIAQADTYLSQDVPQWISSTLAVDTDHAHWAV
GGFSFGGTCAIQLGTRHPDLFPEVLAFSAEAEPAIAKERQKTIDAAFPGD
PEAFLRQTPLAIMADKRFDGHGLYLTAGQNDTEFVGYLRTLAAAARDAGF
TVRDYEVEHTGHSWDTSSRKFGDALQFLADQWGAGG
arts2-a0awd0: Arthrobacter sp. (strain FB24) Putative esteraseArthrobacter sp. Show
MITLTGVELLSGAVPACTAVAAAAAALFLLIRRRRRWWMATGGAFLAAAL
LAAGTGWVLVHAAGVSAQELPLPVTVWMGLAYWAVLLAGLNLAGSSRRRR
ILAPVAMTALILVAALQVNIYFAAYRTLGDMTGASTAAIGALPQAARAVP
RTMPGPASGPKTGPVASTWVKPPGLPATGTISSVQIPGIVSGFAARPAYV
YLPPAYQAPSRPAMPVLVLVAGQPGSPADWITAGGVATTMNAFAAAHEGL
APVVVIPDVNGSAPGNTMCMDSKIANAGTYLATDVPAWIKTTLRVDPVPA
RWAVGGFSFGGTCALQMAALHPDIYPSAIDLSGEAEPALGPDRSATIAQA
FGGNTAAFDAVSPLKVLAAGHYSHSRIYLAAGAQDGTFSGYQARTADAAA
KAGMSVRTVLVPGQGHSWEIPRQTMGPALDWLAPALGLSR
arts2-a0jy61: Arthrobacter sp. (strain FB24) Putative esteraseArthrobacter sp. Show
MDLVADVHLTDGPVLWVAWAAGAAGFGWLLWARGRRWPLSAGAALLLAAG
VVAALHWLLIYTFSALPESLPREVLAWFVAMVFALFLGVLRLWKLRRSSP
AEGPSPPAGVHTWRGRAAAVASILGVLLLGAVQINAYFGLNHTVSDVMGT
AVARIQPLEAGLERQPAAAAPTALAAWRPPEGMPADGVVRKAQIPGTDSG
FSSREAYVYLPPAYQAVPRPALPVLVLFSGQPGGPADWLTGGALRSRMDR
FAADHDGVAPVVVVVDPNGTASANTLCMDSRIAKADTFLARDVPRWIKQT
LDVSADHRQWAAGGFSFGATCALQMGTRHPGTYASVLAFSSEREPALAKE
RQKTIDASFGGDVAAFDEQTPLNIMARTRFEGHAIYFGAGARDPEFLAYM
DELSAAARRAGFAVQADPVANTGHSWEAASKALPAALDFLAPRWGIAP
bifaa-a1a124: Bifidobacterium adolescentis (strains ATCC15703/DSM20083/NCT11814/E194a; L2-32) Putative uncharacterized proteinBifidobacterium adolescentis Show
MLGMGKMRQWLMNISLVGGWFPAAAFAVVAVLSVTLLVSAAVSKRDGRIL
ATVLPIGVAAVSGMIGYVVAWLLSDVFVVFGVGLGSRVMAWVAAGFAIAG
FAIAHIVLSRGMMRVAAAILTVFAILAAAIGIDQSYGEYATIGSLFGEDS
YSQADLTGLAKRKDLITVAQWRKQAANGTIRNIPANGTVNKIDIPATKSQ
FEARKALVYLPPAALADSKRKPALPVVLMLSGQPGSPGRVFQAGGIQTMM
DGYAKTHDGLAPIVIAADQLGADSHNTLCVDSKVYGNALTYLTQDVVDWV
KTNLPAAQDAKDWAIAGFSQGATCSLQIGVNHPDLFGTMIPTDSEIKPTN
GSRQEMIDRFFDGDTTAYENQVPVNAIRNHAPTHQMLIIGAGEKDTTSIR
NVKTIAPVAAKAGMRVAAVESSGNAHDWHAVQDVLRYGLAVFGHDTGLDG
ANPNLSDYPNLKRITI
9bifi-c4fei5: Bifidobacterium angulatum DSM 20098 Putative uncharacterized proteinBifidobacterium angulatum DSM 20098 Show
MLNQPWLKPVMECSLVSGALPWMFWILTIAGMIAVLAFLIKEGERKRVII
TLIATVAGGAIGYLLTWLCSDVFVVFGVEMGAKVIRAVAIGCAMMVLLIC
GIVFLRRWKRALASVAVVVALFATCIHVDAIYEEFPTIGSLFGYTGYSRL
SSAKLRKSTMSVKEWKKLAAEGKMPTTPKEGRIYDASIPAAKSGFKVRDA
MVYLPPAALSAEPPELPVMELMAGQPGSPGRFFQASHIKGMLDKYASKHD
GLAPIVISPDQNGSNSNNSLCADTSQGKAETYLTKDVVDWAKKNLPVSDQ
RWAIGGFSQGGTCATQLGPRHAEQYSLIMAVGGELQPTSGSIEHMVSEYF
NGNKAAYEAQIPANAIKEHAPSDQVMILGSGALDHQSLTNLETNAKAGIQ
AGMTVTKIKVPDSAHDWHAVQAVLKPTIDWFADMSGLGKMTKAINEYESL
EVLP
bifas-c6ahs7: Bifidobacterium animalis subsp. lactis (strains DSM10140/JCM10602/LMG18314; AD011; BB-12; HN019; Bl-04/DGCC2908/R4825/SD5219) Putative esterase, 3 reference(s)Bifidobacterium animalis subsp. lactis Show
MAGIKDWFYAIDVISGWFPVTIWTLVAIGIVVLLICQRKGESRKRFLRQL
GIGLLAGIVGLAATYVCSDVLLLFGVSLGWPVIIAIGVGVFLFAFMIAAA
VMTHGWLRVLSIVMIPVTLLATAVRANAIYGEYQTMGSLFDYSPYPHIST
LDLSLNTISVREWNEQAVAKSRNTTQIPQSGKLVHVDIPNPKSGFKAREA
LVWLPPAAFAKHPPKLPVMVMFAGQPGSPTRFFTASNAIEVLGRFAAEHH
GLAPIVVSPDQNTAATRNSLCADTTKWGKAETYLAQDVPDWIKANLPVND
KASQWTIGGFSQGGTCATQLAPNHPNIYGNVLAVDGEVAPTEGSVDHMVE
AYFSGDKAAYERQVPQNAIRNNAPSKQLMILGAGARDGESVDNIRKIGDT
ARENGWTVFRFAVSNWGHDWHAVNAVFAVALPYLCERMGLGNENVQFPTD
SEVKEIS
bifbr-d4blm2: Bifidobacterium breve DSM 20213 Esterase family proteinBifidobacterium breve DSM 20213 Show
MRNSVWKTLMELSLIRGIVPQTVFGVTAVAALVLLIGLVVGKRNRAHRMH
PLIVSLIVAVAAGAVGLLAAWLVSDVFMAFEVSLGWPVIFTIAGGIAAVG
FVIAAAVIVQGLRRVVAIILVPLILVSTALGVDSIYGEYQTIGNLVGYSP
YASLSSVKVHESAMSVDQWRKRAQRNDLPDMPQTGKVLTVTIPNTKSNFA
ARPAMIYLPPAALSEMPPTLPVMELMAGQPGSPSRLIDAGNIAAMMDSYA
AKHDGLAPIVIVPDQNGEASHNSLCADTTQGNAETYLTKDVVVWAKRNLP
VAKSAKMWAIGGFSQGGTCTTQLGPRHPELYGAMLPVDGELKPTNGTVAK
MVKEYFAGDQSAYDAQVPVNVIAATGSSDQALFSGAGERDKESIHNMRLI
AQAARKVGMDVTELVVPDTGHDWHAVQAVWRAGLDWFGERTGLGEMPQPL
KDYNQVEVLQ
9bifi-b6xub6: Bifidobacterium catenulatum DSM 16992 Putative uncharacterized proteinBifidobacterium catenulatum DSM 16992 Show
MRAWLMNISLVDGWFPATLFSITAVLAAILLGIAIWEMVDGSRGGGKRAI
AVVACPMVIAVIAGIVGLVIAWLLSDVFVVFGVELGPRVIAWAGCGCAIV
GFAVSHVMLHRGVLRAVAVILVVCAVFSTATGIDQAYGEYATIGSLFGQD
SYREADLTGMAKRSDLISVTQWRQEAADGSISDIPAHGEVSKVNIPATTS
HFEARQALVYLPPAALVTAKHKPALPVILMMSGQPGSPGRVFAAGGIQTM
MDDYAQHHGGLAPIVIAADQLGDDSHNTLCVDSPVYGKALTYLTKDVVDW
VKTNLPAAWQAQDWAIAGFSQGATCSLQIGANHPNLFGTIIPTGSELKPT
NGSESSMISRFFHGDRTAYEKQIPINAIRNHAPSNQTLVIGAGERDRESV
RNVELIAPVAQQEGMHVTAVESLGNAHDWHAVRDTLRYGLVVFGYNTGLS
DAKPKLADYPNLKRITI
bifdb-d2q9l6: Bifidobacterium dentium (strains ATCC 27534 / DSM 20436 / JCM 1195 Bd1; ATCC 27678) Putative uncharacterized protein, 1 reference(s)Bifidobacterium dentium Show
MRQWLMNVSLLQGWLPATLFAITAALIVILLIGAIATIRKAGLKPVLMPL
VVAAVAGAVGFVITWLLSDVFMVFGVELGPHVFVWTSAGCATVGFAVTHM
AMRRRASRALAVILVIFALLASALGIDQAYGEYATLGSLFGVDSYHEADL
TGMADRRDLITIAQWRQGVADHTIRNVPSHGAVDKVDIPATTSGFKARKA
LVYLPPAALVPTKAKPALPVILMLSGQPGCPNRVFNAGGIQTMMDDYAQH
HQGLAPIVIAADQLGADSHNTLCVDSQVYGNALTYLTQDVVDWVKDNLPA
AQDAKDWAIAGFSQGATCSMQIGPNYPNLFGTIIPTGSEIGPSNGSEQEM
IDRFFDGDREAYERQIPINAIRNHAPSDQTLIMGTGEKDVESLRNIEEIA
PVARKAGMHVTAVESLGNAHDWHAVQDTLRYGLAVFGYDTGMSSVKPKLS
DYTNLRRIKIS
9bifi-d1nuq2: Bifidobacterium gallicum DSM 20093 Esterase family proteinBifidobacterium gallicum DSM 20093 Show
MVAWHAVRIVDGWLPITVYTVCVVLMIVLAVSQLSTQRRGRLGRQIVAAL
VTGVVAFIAAYVVSDVRMSFGVSLGWYVISSFAVGMAVFGWAVAALISAA
GWRKIVAGLLVPVSLLSTAVMINSLYGEYTTLGSVFGYDDDLNFSSVQLS
LSHTISVAEWKQQQASGHSQRMPDEGRQYTVEIPATDSGFKARPAIVWLP
PAAFAKHPPKLPVMVMLAGNPGSPGRYFGASNTVEVLTKYAEQHGGLAPI
VVSPDQNGADDINAMCANTKTHGAAETYLTVDVPRWIRTHLPVQTEASQW
TLGGFSQGGTCAVSLGPNHANLFGTLVSVDGELQQTSGSVDKMIREDFGG
DHAAYERQVPLNAMRAHAPSHQTLILAAGSQDKDAIQVLDPLAQAAREAG
MHVTRIISKDAGHNWKAVNQVFEWALPWIAARQGLSDNPQPISDFPALEV
EQ
bifli-c2gxu7: Bifidobacterium longum (and subsp. infantis ATCC 55813; CCUG 52486; DJO10A; ATCC15697/DSM2008/JCM1222/NCTC11817/S12) Esterase, 4 reference(s)Bifidobacterium longum Show
MKNSVWKTFMELSLVRGIVPRTVFGLTAIAAIILVIGLALSKSNKRGRLH
PLIVSLIAAVLAGAAGMLVAWLVSDVFMVFGVSLGWPVIFTIAGGIAGVG
FVIAAAVTMRGARRVLAIVLVPLVLLSTALGVDSIYGEYQTIGTLVGYTP
YASLGSIEVHKAAMSVSDWRSKAQKGSLPSMPSQGKVLTVDIPNAKSNFT
ARKAMIYLPPAALSDRPPALPVMELLAGQPGSPSRLIDAGNIAATMNAYA
AKHDGLAPIVLVPDQNGEATHNSLCADTTQGNAETYLTTDVVNWAKKMLP
VAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELKPTNGSVAK
MVQEYFAGDRKAYDEQVPVNAIAATGTPEQALFTGAGERDKESISNMRTI
ADAARKAGMEVTELIVPGTGHDWHAVQAVWRPGLDWFGERTGLGEMTKSL
KEYPQVEVLQ
korve-q1itz6: Candidatus Koribacter versatilis Ellin345 Putative esterase, 1 reference(s)Candidatus Koribacter versatilis Ellin345 Show
MQKQFPNAQLSGLIPGSENLRFLNFRGNALPGRGDVLLFAPPGFESMHDV
PLLLLLHGVYGCQWNWWLNGAIDRTGLAMLQDGSTTPMMIAMPSDGLWGD
GSGYVPHAHANYEAWIADDIPTCLRELFPQLRSDKFFIAGLSMGGFGAMR
LGMKYAARTLGISAHSSVTHASQLSRFIPYPPDAFLFAGEQETDLLYWAK
TNLTHLPPLRFDCGTEDSLIEQNRKLHRELSDLGVPHTYEEFPGGHDWPY
WTEHVRSTLAFCKRVLER
catad-c7q7s8: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR / 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MSLTSTALLILAVCSAVAAPAATYVLWNRARGPRPVRAAARLGLIGLCQA
TMLLLVGLLVNNHYSLYASWSDLLGQDGGGPVAVRQATDAATDLNHPVTS
STDSRGRFGFGGHGQGSHSTPPSTPRTGNAGNTAKPAWVSGNHGTLIAAF
RGPHSGIGGNSGDVHVWLPPQYHDPAYANTRFPVVMLFPGYPGSPTGWFS
VLNGGQILGQMAARQQATPFVLVAVNVNQHGENLNCSNIPGGPQMATYVA
EDVRTMIEANFRVSDQRTGWGLMGFSDGGLCAGKLLMQYPQYFRSAAQLA
GDSTPDGDQVVRAGAAFVERNSTLWLLKHHHPSANQPVSLLASVSDQDTD
SLPVAFQLQAAAPDIVSVSEHAHGAHNPAVWRSWLPEMYTWLSRHLDKAS
G
catad-c7qfj4: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MSPTGWPMTVTAILLAVAAPIGTYLLWNRIRGPRPVRAVARLSMIGVSQV
MAILLCGVVVNNYYGLYASWDDLLGQTGSPGVIIHQNAVAAGTPIAGTAV
NGGRAQGGRGQVVPRVRPAGPVQTFKKYGDDALAASFTGPKSRLGGDNNV
LVWLPPQYNDPAYANTDFPVVMLFPGYPGTPQTWFGQMDGQKELAALVQQ
HTSTPFVLVAVNISPIKGVNTDCTDIPGGPQVATYITDDVRTMVERTFRV
TTDRSGWGMMGYSEGGLCAGKLLVQYPQLFSAAVQMSGDVRPGGYVSKYG
PTFADQNSTLWVLQNHKPNPPVSLLAAASAEDAHGSVLSDALSLQHVAPD
VVDVLKKDHGSHNTAVWKQWLPQAYGWLSQHLDQVHPQA
catad-c7qh95: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MAASARGHRRAPKRSRRSPLRAVALFVISTALVVGSGVAFGYATHHLGKH
QVTDDASVVAPPTGPLSDATDDPSATTNSAPGGKPSVPASPRPSLPKATG
PGKVTELKVASSDDDWPSRPVFVYRPAVPANVVLPVVYLLHGVPGEPDRI
MDAVKAVLDKAFTSGGEQPFIVAAPTGEGTAHNDTEWADAVDGKDMVETY
MIKDVIPAVEGKTPRPAGMRAIVGFSMGGYGAANLTLRHPDLFDQFASMA
GYFRVDDPDGMFGSDSKIEAANTPDDMVQKAAGKRVLLLEDQQDPDPLIQ
GEASEFAKRLDDCNCGVDLSWHLEPGGHTYDFVTDSFPKVITFLNQGFTA
PAGTTPSAAG
clams-b0rcr0: Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / JC9667 subsp. michiganensis (strain NCPPB 382) Putative uncharacterized protein, 2 reference(s)Clavibacter michiganensis Show
MLHDLADLPIISASFVTASTVVPIVGLALLLLIARRARIRTGARAAAPRR
AARAILIGAVAGGLAGLALTWVLGDLLDLFGVILSVPTRVWTALGGLGLG
VAGVVVARSRSAVTGVGGRGAPPRGLRILHTVLAVLIAPLVVFATAIGIN
ADLQEYPNIAAAFGISRISPLDVSALPAPDAAGAPVDAASTAPVAETWRA
SENLPARGRVGSVTIPGTQSGFAARDGLVYLPPAALVSDAPALPVVVAMS
GQPGSPLDLIASGRVDRVLDEYAAANGGLAPIVVIPDHLGAQDANPMCVD
SPLGNTSTYLTVDVPAWITAHLRVLPGADRWTILGFSQGGTCAAQIGSAR
PDLFGTIVDISGEVAPTRGGDTVAAAFGGSQARYAAAFPAAIMESRAPYP
DSTAFFCVGEVDQQYRPEVEQIEAAAKAAGMDTRMSTAPGRAHDWGAVNT
CVHGILPPLGQRLGLTR
cora7-c3pft2: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans) Putative membrane protein, 1 reference(s)Corynebacterium aurimucosum Show
MNNFIQSVLGLPLTDPVNGGIYIAIVVISALLIAWRLRKRDFVSFLLAAV
IATVAFFVLKHWDVPFHLFVAGLVPIAALISLIHHAGRRVLMAVIAAFST
LAVAGLANMEYQSYPDIGSLDPTPVAQEMDYAQFKAMKSSDSAAIVHLDL
PGTNSGFTARQATAYIPPAYWTQPERKLPVLVLLHGNPGGPEQWFGSGEA
AETADAFQRANGGLSPIVLAVDATGSETANPICADTSAAKVMTYLTTDVP
TGIKSAFRVDENQQHWTVTGLSYGGTCSLQILTNHPEAYGQAVDISGEAE
PTIGNHAATVSKFYGGDESAYQAANPAHLLEVKKYPDNQAIFIAGNRDNN
AVNALSQLNDAARAAGMRTFYTTRPGGHSFEVWRPALREVFAWVARRGGL
ADLTDPFDGVQDADLQR
cordi-q6nhd8: Corynebacterium diphtheriae Putative membrane protein, 1 reference(s)Corynebacterium diphtheriae Show
MSRVLSISLTQPLMMWFFMGLCVVSLLMIVYAVWRPWRVKGVVITLVAIT
VGAFAAKIIVEKLWRPFPDSIPISIYFAVALTVIALFATMFIRRRILLFI
ALCLSLVGSAGVANLTYQLYPDLRSLVPVEVAREMSYSEFAHVSKAPTAQ
GREIGAKVTFSLVGEKSSFPARDAIAYIPPSYWTKQADSLPVLVLMAGSP
GSPSDWFESARVDTVADEYQRTHDGKSPIVISVDATATLGGDPLCVDGPE
FKVMTYLTQDVPTGIKNAFKVNSDQSQWTIGGLSYGGTCSFQVITNHPSA
YGHFLDFSGQDELVSGTHEQTLAKFFGGDQKRYDDSNPAAILKKYSDGNR
FGSISGVFVAGSQDAESQKGLKRLNDLAQHAGMHTQYLEVPGGHDFGTWR
EAIRATFALSAQYGGL
9cory-c0vxq3: Corynebacterium glucuronolyticum EsteraseCorynebacterium glucuronolyticum Show
MLESVELTGPTQSVLFWAALVVPALFLLTRQKCRLTMASVLIIGIVVAVA
WALHAPPALAVGGGLLLLLLSACRRPVHALFVAVAVVGSIGIINTQFQMV
PTVGAITNWVDYVPYRDLASVRPGQSVRTSLVLGRGRPAEVYLPPAYFEG
KRPPVLVLMHGNPGSPSMWMDEGQAPQLFDEFQATHSGMAPVVVSVDATG
SFTGNPLCVGWAHDYISDELPQAITQFFRVDEDRSHWVLGGLSYGGTCAL
QIATTAPDAYGGYIDMSGQREPLAGTKQETVDKYFGGDPQTYRENNPRDL
LGDTRKYVGIPVRFIVGEDDRDYRPGIEELYGLAQQAGMNATLAVLPGGH
DFRVWREGLIDSLDFIATIGGIDHA
corgl-y967: Corynebacterium glutamicum (Brevibacterium flavum) (and strain R) hypothetical protein cgl0967 (orf2), 3 reference(s)Corynebacterium glutamicum Show
MNEWRTVSLVDSTALTVIISVAVFTSAVALLGVVKKRSRWRVLGALISSA
VLTSGAWVVIEKLWKPFPDPNPWTIYLSAGLAVFPLLSILFRTGRTRILM
ATLTVIALVNTAAVINVIYQPYPTLGSFNPVPTAVSMSYADFESQTTAPT
MDDREVGALVQVPLAGTTDDSTSGFDARDAYAYIPPAYWDNPSLQLPVLV
LMPGNPGQPDQWFSSGNADQTADNFQATHDGISPIVISVDGTGSFSGNPA
CVDSDAQSVMTYLSHDVPMLIKQKFRVNQDQRTWTIGGLSYGGTCALQIM
TNHPEAYGSFLDFSGQEEPTLGTRQQTVDQLFGGDEDAFKAVNPEDLLNQ
AISSGAHTYSGISGRFIAGSNDKSAVSALSHLDNLSNQAGMSTTFDTVAG
GHSFQVWRVALANTFDWVAKRGGLQV
corjk-q4juz4: Corynebacterium jeikeium (strains K411; ATCC 43734) putative membrane protein, 1 reference(s)Corynebacterium jeikeium Show
MTEFVRNIPLTGTWPEVITWVLIFATLTALFCSLPTEPAGRRKRAMIWSI
GVTTILTCGGLVLLMWGTTTPWSELGFRLVAGAAALILAANLAGWCVGAS
IKKIWTILLVAVLAVGSAAVANQSYELFPDVGQVDPIKLRTFNSVDELPK
AQAIPLKEWRKAKHENMPAEGSILNVSAPKKKSGFQARDMRVYLPPAWFT
SPRPQLPVLVLLAGIPGDPDQWFDTGDATDVARKYQQAHGGVAPIIISAD
ATGGTWDNPVCTDSNKGKVQTFLTEDLPSWVQRHLSPNPDQRTWTIGGLS
YGGTCTFQVITNHPDTYGSFVNISGERTPDDGISHESTVRNFFGGSEEKF
KAHNPEDLLKRRTYPHTAGMFIAGRDDDQAVGDLKRLHQLAVKAKMDVSY
NEVAGGHNFRTWRSGLALAFPFIARRGGLGN
cork4-c4lh42: Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) Putative membrane protein, 1 reference(s)Corynebacterium kroppenstedtii Show
MAGPGKTWKPFGGGTAIGVYVAGWALIVLIGLAIGSYCARGQTRLVPWFK
RMRATGPRSSKPRASFSQRWASIRWKSVARVVGACAAFVCGTVACVNVVN
NSFALYPSVDSLVGKEPYTTAQYADVKGTSTSFTPPQGSTIAGAWNGVSP
RNKGVLVPFMIPSPVSHFQTTESRVYLPPAYFANPRPLLPVVVLMNGLPG
SPSQWFEIGNAGQTLHHFERVHHGLAPVVVAINTTGNDDEDLGCFDTKKA
KVQTYMDTDVPQQIKKYFQVSNDPTQWAIGGLSYGGTCALQAIVNNPEPY
RYFLDFSGDRTPGTMSAKGNADTYFGGNLNAYLRVNPEDILKRRKFTGIK
GVFVAGQSDKSSVRDLKYMNGLAQSAGIDSSSREVPGGHDFGTWRLALVL
TLPDVARATRLIG
9cory-c0dzk6: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MAHVYQWLSIPITNLAAVTLFLAALVALAIWVGWRKPYRILVRSALISAL
FTGAFWLLYDVIIIPYMEKLMPILYPGIALLAFIIPLSINKRGIIAIAAT
ILPAMGLTNAAYDQYATLADLLPSRNVVPLTYQEFQHQQAAPTIDGNPVG
ALVSVDIPASKSGFPARTSLAYIPPAYWSGAHLPVVVMMAGNPGSPGQWF
GPLNAQAALQSFQAAHHGVAPIVFSIDATGSTNGNPLCIDGPEYKVHTWL
ADDVPTGIKRMFTVDSDQNHWTIGGLSYGGTCALQVVTNSPSSYGTFISY
AGQGEPIYKDHTTTLKMFFNNDEAAFQAVNPMNLLQHPTPERRAEYRRLA
GWFIAGTADEHSQQALRQLHEIAQNAGIDSRYTEIPGSHTARVWRTGFGQ
TLPFAAARGGLTAVADKGADSGAEATSTNTTAASTKGRAA
corst-c2cl78: Corynebacterium striatum ATCC 6940 EsteraseCorynebacterium striatum ATCC 6940 Show
MNFFLDLPLADPVNGIIYVVILVGAVGLIAWTRKIKPVLFAVAAAIIAWL
FLRHWDVPVYILIAGAIAIAALLRKPKTSTVIAGLLSLIALAGLVNLEYQ
TYPTVGSLDPRPVAQEISPWQLPTYKGQGAATVHLNLQGEKSGFKAREAI
AYLPPAYFRGQRLPVMVLLHGNPGGPEQWFGSGGAAQTADQFQAANGGVS
PIVIAVDATGSETGNPVCADSARAKVMTYLSQDVPAAIKKQLRVDEDQSH
WSLAGLSYGGTCSLQVATNHPASYGSYMDFSGQAEPTLGNHSDTVTKLFE
GDERAFQAQNPAHLLQNKKYPNLAVAFISGDKDKDAQSAQNDLAEMLRQA
GAKSYVATLPGGHSFGVWRPALRQTFAWAAARGGIQVERDPFDGIKESDV
HA
cyap8-b7jzw1: Cyanothece sp. (strains PCC 8801; 8802) (Synechococcus sp. (strain PCC 8801 RF-1; RF-2)) Putative esteraseCyanothece sp. PCC 8801 Show
MVLKLKPILLIGTVILSLMTATAYWYVFIAGAPQFDPPAISAPGSDLTFK
MESFKSKAMGTVRQYGLILPPDYDKQPNHRYPVIFLLHGGHDDARAWFDK
YGIVPVLHQLYQSNKLPPAIIITPDGNDQRGSSPLWDPDYYDGPNGKVGT
LIGTELVQVVKSRYRTLNLPQFWAIGGLSSGGWGAVNIGLHHLNNFNVLF
SHSGYFTDDSGTNNSPQVFIKKIPTTQLKNLRIYLDAGKADPDFLAESQK
FHQTLTQLGVENVFYAFPGGHGLSGSDYGWNYFHKHSIDSLSYVGQQFKK
SAENLDLKTKL
fraaa-q0rhz6: Frankia alni (strain ACN14a) Putative integral membrane esterase, 1 reference(s)Frankia alni Show
MGSLVIIGKWFLLAFAGATLAAWVGCLRFARRGRRAVTAGMAGVAVVLTL
ATAADLVNAHYGYLPRVDDVIGVRSWPTASTHDAVTATPARTHPHGSVVD
LPVPGVRSGFGVQQALVYLPPQYFTEPHARFPVVYLLHGSPGVPVDWYRA
NRAAQTGAWLADDHRPVILVAPRLSHGWLDDSECVDRPGEHIETYVVDDV
IPTVDARLRALPDRADRVFAGMSAGGFCALNLGLRHRDLVGTIVDMSGMD
RPTHDGGMVGLFGHRLDLAQVVEANTPARYAATLAPDPPMRIWFDCGLGD
HEALGDTRAMASILGARPGFTVRLRLRPGAHDFGVWRPALRDGLAWALAP
ASGVPVGLPAARAALRPGTGVPAAA
frasn-a8lbd8: Frankia sp. (strain EAN1pec) Putative esterase, 1 reference(s)Frankia sp. Show
MGSALGSLVIVATWFLLVLGALSAICWAGCVWMTRRRRAMAVGLGFLAAL
LTLATAADTANAHYGYLPRAADVLGLTSWPTASVREVVGPAPRPHPDGAV
VHLPIAGVHSGFGTHSALVYVPPQYFTDPGARFPVVYLFHGSPGIPLDWY
RAGQAAKTGAALARAGRPAILVAPPLGHGWLDDSECVDRPGERIETYLVD
DVLPTVDNLLRAIPDRADRVFAGISAGGFCALNLGLRHRDLVGTIVDISG
LARPTHSGGMTGLFGNRPDLAAVTAANTPESYSATLPPNPPTRVWLSCGL
MDFGPLGDIRKMALALYGRPGFTTVLRPRPGGHDFGVWRPALRDGLRWAF
P
frasc-q2j9d8: Frankia sp. (strain CcI3) putative esteraseFrankia sp. CcI3 Show
MGSLVVIGKWFLLSLAGMSLACWAGCGWLAHRRRAGHRNRVGRPAAFGMG
VLAMLLTLVTAADLVNAYYGYLPRVDDVIGVKSWPTGSAREAVAPAPPHP
DGSVIDLLVPGTHSGFGVKEAKQALVYLPPQYFTEPHVRFPVVYLLHGSP
GVPVDWYRAGRAAQVGALLAGVGRPAILVAPRLSHGWLDDSECVDRPGEN
IETYLIDDVISTVDRRLRAIADRADRIFVGMSAGGFCALNLGLRHRDLVE
TIIDMSGMSKPTHDGGMVGLFGNRPDLALVVAANTPARYAATLPPFPPMR
VWLDCGHGDHEALGDTEAMARALGERPGFDVVLRLRPGGHDFGVWRPALR
DSLLWAVPPGVTIRPA
9acto-d3d892: Frankia sp. EUN1f Putative esteraseFrankia sp. EUN1f Show
MGSVVIISGWFLSALVALTVICWAVYALLAVRRRGRAGPIAVGFLAFLLT
VATAGDLVNAHYGYLPRLDDVLGVKSWPTASAGEALAPGSGRRYPDGVVI
ELPITGTHSGFGTRDAMIYLPPQYFTEPRTRFPVVYLLHGSPGVPIDWFR
GGEAAQIGADAAAGRSPGHGPQPAILVAPRVSRGWLDDSECVDGATEHIE
TYVIQDVIPTIDARLRSIPARTDRVLAGMSAGGFCALNLGLRHRDLVATI
IDLSGLTRPTYDAGMAKLFGPRPDLAQVVAANTPARYASTLPPNPPMRVW
LDCGRDDHEPLDDIREMARVLSRRRGFTVTPRLRPGGHDFGVWRPALREA
LRWAV
9acto-d3m8h4: Frankia symbiont of Datisca glomerata Putative esteraseFrankia symbiont of Datisca glomerata Show
MTGAGLGSLAIIGKWFLLSLAGLTAICGAGCALLARRERAVSVGLGSLAL
LLTLATVADLVNAHYGYLPRFDDVIGVKSWPTASAREIVGQAPRPHPDGS
VVGLPVTGVHSGFGTQEALVYFPPQYFTEPHTRFPVVYLLHGSPGVPVDW
YRGGQAAQVGAMLAHDGQPAILVAPRLSHGWLDDSECVDRPGEHVETYLV
DDVIPTVDARLRTIPDRADRILAGMSAGGYCALNLGLRHRDLIATIVDMS
GMTRPTHDGGMAGLFGNRPDLAFVAAANAPALYALALPPDPPMRVWLDCG
RGDRESLDDTRNMALTLSRRPGFTTVLRLRPGGHDFNVWRPALRDGLQWA
VPTASPASADRHTRVLQRHHARVAAA
garv4-d2rbq6: Gardnerella vaginalis (strain 409-05) Putative uncharacterized protein, 1 reference(s)Gardnerella vaginalis Show
MLQLAKVSLLQGWLPVSLFSVNGISLVLLLFMKTKRGKKMFHLLIQLAIG
VITFFVGGIIAWLISDVFLVFEVSLGWLVIFSIACGFGLIGFAATAFVFL
HKWRKLVAVIAIILTLASTALHVDMIYGEYTTIGSIFGMGGFPKLEVNKQ
KSASSSIKQWRELAAQQKLPKLPKKGIVRSVYIPNTASHFNARIANVYLP
PAALVKKPPKLPVMVMFAGQPGSPNHFFAASDIANTLDNYAKNHYGLAPI
VVAPDQNGESSHNSLCADTHVFGKAETYLINDVPKWIRKHLPVSKDPKMW
LMGGFSQGGTCSTQLVPSHPDIFGNIFSAGGELEPTYKNRQETINHYFNG
NTSEYERHIPSVIMRKNAPLKQNYYAIAGSWDTKSQANQATIALSAHRAG
MNVITMLSQGNGHDWHTVKAGLKIAIDQFCKKTGISSTAPKLNTYQNVQI
LINQQVNRD
gemat-c1ac83: Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBR 100505) Putative uncharacterized proteinGemmatimonas aurantiaca Show
MRILRALAALVLGTSLTAPAAAQAQTGTGTVRTDTLWAQALGVQKALTVY
LPPSYHRGTSRRYPVLYYLHGKTGNERNWVDAGALHRTMDSLIAAGAPEA
IIAMPDGDDGWYTTWGVLPDMGPCERDTTRREPAATYCVPWTRYDDYITF
DIVRWVDSHYRTRADR