Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: A85-Est-Putative

A85-Est-Putative


Genes:Proteins in A85-Est-Putative (96)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
myctu-RV1639C: Mycobacterium tuberculosis, Mycobacterium bovis, hypothetical protein rv1639c, 6 reference(s)Mycobacterium tuberculosis Show
MAQNELVTASTPPAATQPLAVGHTSLMHGWVPLAVQVVTAVVLVLAAGWR
SRHWQRRWLPTAAAIGATLAWGTRWYVTGNGLANERPPSTLWIWVALTGA
AATVLILGWRSARWWRRGASLLAVPLCLLSATLTLNLWVGYFPTVQTAWN
QLTSGPLPDQADQAAVAALAHSGVRPSHGTLLPVVIPSDASHFKHRGELV
YLPPAWFDREHRSENPPPPQLPTVMMIGGQFNTPADWARAGNAVKTLDDF
AAAHSGNAPVVVFVDSGGAFNNDTECVNGRRGNAADHLTKDVVPYMVSKF
GVSPEQTSWGIVGWSMGGTCAVDLTVMHPTLFSAFVDIAGDFYPNAGNKT
QTIVRLFGGNEDAWSAFDPTTVITRHGSYTGLSGWFAISSPGPPSPDNAV
ADTTTMRLAGRDAAANPGNQAAAANALCALGRANGIYCAVVPQPGKHDWP
FADRVFAAALPWLAGQLATPGVPKIPLPGTTQQIAGTGR
bifli-c2gxu7: Bifidobacterium longum (and subsp. infantis ATCC 55813; CCUG 52486; DJO10A; ATCC15697/DSM2008/JCM1222/NCTC11817/S12) Esterase, 4 reference(s)Bifidobacterium longum Show
MKNSVWKTFMELSLVRGIVPRTVFGLTAIAAIILVIGLALSKSNKRGRLH
PLIVSLIAAVLAGAAGMLVAWLVSDVFMVFGVSLGWPVIFTIAGGIAGVG
FVIAAAVTMRGARRVLAIVLVPLVLLSTALGVDSIYGEYQTIGTLVGYTP
YASLGSIEVHKAAMSVSDWRSKAQKGSLPSMPSQGKVLTVDIPNAKSNFT
ARKAMIYLPPAALSDRPPALPVMELLAGQPGSPSRLIDAGNIAATMNAYA
AKHDGLAPIVLVPDQNGEATHNSLCADTTQGNAETYLTTDVVNWAKKMLP
VAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELKPTNGSVAK
MVQEYFAGDRKAYDEQVPVNAIAATGTPEQALFTGAGERDKESISNMRTI
ADAARKAGMEVTELIVPGTGHDWHAVQAVWRPGLDWFGERTGLGEMTKSL
KEYPQVEVLQ
bifas-c6ahs7: Bifidobacterium animalis subsp. lactis (strains DSM10140/JCM10602/LMG18314; AD011; BB-12; HN019; Bl-04/DGCC2908/R4825/SD5219) Putative esterase, 3 reference(s)Bifidobacterium animalis subsp. lactis Show
MAGIKDWFYAIDVISGWFPVTIWTLVAIGIVVLLICQRKGESRKRFLRQL
GIGLLAGIVGLAATYVCSDVLLLFGVSLGWPVIIAIGVGVFLFAFMIAAA
VMTHGWLRVLSIVMIPVTLLATAVRANAIYGEYQTMGSLFDYSPYPHIST
LDLSLNTISVREWNEQAVAKSRNTTQIPQSGKLVHVDIPNPKSGFKAREA
LVWLPPAAFAKHPPKLPVMVMFAGQPGSPTRFFTASNAIEVLGRFAAEHH
GLAPIVVSPDQNTAATRNSLCADTTKWGKAETYLAQDVPDWIKANLPVND
KASQWTIGGFSQGGTCATQLAPNHPNIYGNVLAVDGEVAPTEGSVDHMVE
AYFSGDKAAYERQVPQNAIRNNAPSKQLMILGAGARDGESVDNIRKIGDT
ARENGWTVFRFAVSNWGHDWHAVNAVFAVALPYLCERMGLGNENVQFPTD
SEVKEIS
corgl-y967: Corynebacterium glutamicum (Brevibacterium flavum) (and strain R) hypothetical protein cgl0967 (orf2), 3 reference(s)Corynebacterium glutamicum Show
MNEWRTVSLVDSTALTVIISVAVFTSAVALLGVVKKRSRWRVLGALISSA
VLTSGAWVVIEKLWKPFPDPNPWTIYLSAGLAVFPLLSILFRTGRTRILM
ATLTVIALVNTAAVINVIYQPYPTLGSFNPVPTAVSMSYADFESQTTAPT
MDDREVGALVQVPLAGTTDDSTSGFDARDAYAYIPPAYWDNPSLQLPVLV
LMPGNPGQPDQWFSSGNADQTADNFQATHDGISPIVISVDGTGSFSGNPA
CVDSDAQSVMTYLSHDVPMLIKQKFRVNQDQRTWTIGGLSYGGTCALQIM
TNHPEAYGSFLDFSGQEEPTLGTRQQTVDQLFGGDEDAFKAVNPEDLLNQ
AISSGAHTYSGISGRFIAGSNDKSAVSALSHLDNLSNQAGMSTTFDTVAG
GHSFQVWRVALANTFDWVAKRGGLQV
clams-b0rcr0: Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / JC9667 subsp. michiganensis (strain NCPPB 382) Putative uncharacterized protein, 2 reference(s)Clavibacter michiganensis Show
MLHDLADLPIISASFVTASTVVPIVGLALLLLIARRARIRTGARAAAPRR
AARAILIGAVAGGLAGLALTWVLGDLLDLFGVILSVPTRVWTALGGLGLG
VAGVVVARSRSAVTGVGGRGAPPRGLRILHTVLAVLIAPLVVFATAIGIN
ADLQEYPNIAAAFGISRISPLDVSALPAPDAAGAPVDAASTAPVAETWRA
SENLPARGRVGSVTIPGTQSGFAARDGLVYLPPAALVSDAPALPVVVAMS
GQPGSPLDLIASGRVDRVLDEYAAANGGLAPIVVIPDHLGAQDANPMCVD
SPLGNTSTYLTVDVPAWITAHLRVLPGADRWTILGFSQGGTCAAQIGSAR
PDLFGTIVDISGEVAPTRGGDTVAAAFGGSQARYAAAFPAAIMESRAPYP
DSTAFFCVGEVDQQYRPEVEQIEAAAKAAGMDTRMSTAPGRAHDWGAVNT
CVHGILPPLGQRLGLTR
strav-SAV4674: Streptomyces avermitilis putative membrane protein, 2 reference(s)Streptomyces avermitilis Show
MGLTSNKVLVLAAFFAVLLFIGTVWLWPRLARRNWRAVGGRVALLLATQV
AIFASIGVAANQAFGFYASWADLFGRESGQGVVVDHNAGGGSGGGPLQML
GTQPVNVTGGGRPQLGGQIQKVGIVGRTTHIATRAYVYLPPEYFQPQYRT
RTFPAAVVLTGYPGTAEALIKGLHYPQTAHELAKNGQVQPMILVMLRPTV
APPRDTECVDVPGGPQTESFFAKDLPDAVLAHYRVGRKPGSWGIVGDSTG
GYCALKLAMHHPKVYAAGAGLSPYYKAPLDPTTGDLFRGDKGLRNRADLF
WYLKNMPAPDTSLLVSSSRIGEANYQNTLKFMEQVKAKRLTRVSSIILDS
GGHNFNTWRREIPGTLQWISGRLSDR
strco-SCO3396: Streptomyces coelicolor, Streptomyces lividans, putative membrane protein, 2 reference(s)Streptomyces coelicolor Show
MGLTSNKVLALAVVAGVLLFAGTVWWWPRLAGRSVRAVLGRAGLLLATQV
AVFAAVGLVANQSFGFYGSWADLFGREDGQGVVVDHSAGAGGGPLRVVGD
RRVAPAGGARPDVSGRVEEIRVVGRTSRIASPAYVYLPPEYFQTRHRGRT
FPAAVVLTGYPGTAEALVEKLHYPRTALELAKAGRMRPMILVMLRPTVAP
PRDTECVDVPGGPQTETFFAKDLPQAVSTHYRVAKGPRSWGVVGNSTGGY
CALKLAAHHPEVYAAGAGLSPYYDAPNDPTTGDLFQGDEGLEKRASLWWC
LKNAPAPDTSLLVTSSRTGETNYKDTLKFIDLVKGKRPTRISSIILESGG
HNFNTWRREIPATLRWLDERLDGGRDA
korve-q1itz6: Candidatus Koribacter versatilis Ellin345 Putative esterase, 1 reference(s)Candidatus Koribacter versatilis Ellin345 Show
MQKQFPNAQLSGLIPGSENLRFLNFRGNALPGRGDVLLFAPPGFESMHDV
PLLLLLHGVYGCQWNWWLNGAIDRTGLAMLQDGSTTPMMIAMPSDGLWGD
GSGYVPHAHANYEAWIADDIPTCLRELFPQLRSDKFFIAGLSMGGFGAMR
LGMKYAARTLGISAHSSVTHASQLSRFIPYPPDAFLFAGEQETDLLYWAK
TNLTHLPPLRFDCGTEDSLIEQNRKLHRELSDLGVPHTYEEFPGGHDWPY
WTEHVRSTLAFCKRVLER
actmd-c6w9s6: Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMR3971) Putative esterase, 1 reference(s)Actinosynnema mirum Show
MLDWSLLPGARLAVAVVVAGAVALVALLLGRARRWWSRRVPLAVGVALAL
TGVAWAVVTLSRLTAYPLPPVVWGSVLAGSLALALAGVRLAARPWRWRRL
VALPLALVVLLGAGQAVNAHFGQYPTPRSALGLPRADEVDLAEVPPVDDG
VVPAPEGASVASAWTPPADLPKQGVVAQVTIPGTVSGLAARPGWVWLPPA
YLVVPRPLLPVLVLVNGQPGAPGDWLAGGRLAERMNAYAAEHAGLAPVVV
VPDDLGGSSVGNPMCLDSALGNARTYLVRDVPDWITSTLRVDPDPAAWAF
GGFSHGGTCAVQMAVTATDRYPTFLSISGEDEPRRGTRQQTVADAFGGDE
AAFRAVNPRDVLAGARFPQVAGRFVVGEGDRDFRAQGERMFAAARDAGMD
VELVVLPGQHGWEVWGPGLTRWLPWLGDRLRLTR
artat-a1r4v1: Arthrobacter aurescens (strain TC1) Esterase family protein, 1 reference(s)Arthrobacter aurescens Show
MNELLKLEISGPLVMTIAGVIGAGFFLLLFLRPSARWALTAITAIVVAAL
FGWLTVWIVEDVLDVFHVGLTPRVWFWAISCFAALGLAVVSFRHSPRWRK
VVAAVSVPVFLLVAALGINTEFGLNKTLGSALGISTEDAIQLAKPDPDAS
SPAGPLWQSWKPPADQPSKGEAGTQVIPATASGFNARPAGIYLPPAALAA
HPPKLPLFVLMMGQPGLPDPQYVSAALDEFAAKNNGLAPIAIVADQIGPD
QDDTLCLDTAKYGNVEKYINEDVVNWAKANLNILPDREHWTIAGYSNGGQ
CAISFAVKYPEMWGNVVDISGEEFPGAEDPAGNLAAIFNGNQAAYDAQKP
INIMKGKQFPNTTAVFTVGSDDTTYVAAAKAVSAAARNAGMTVTYYEVPN
GGHVGLALNAGLTKGFEVLYPRLGLSR
artat-a1r7v1: Arthrobacter aurescens (strain TC1) Putative esterase family protein, 1 reference(s)Arthrobacter aurescens Show
MDFLSDVSLVDGPFLWFSIACGAAGGAYLLWRRRRSWLLLVLASLVVSIG
AVALIHWVLVDLTATFSENLPFETLAWAVPAVAAVLLCAARFPQSSWRGR
SLSVAAVLGVVLLCVVQINLYFGLNNTVSDLLGTAVARIQPLEASLKRAA
DAKPGPALSAWKAPDSMPRNGIMRKAGIPGTASGFTAREAYIYLPPAYQT
VPRPSLPVLVLFAGQPGGPADWLSGGQLRTLLDKFAEAHQGIAPVTVVVD
PNGSANANTMCMDSNIASVDTYLSQDVPAWITETLNVSKDHKQWAVGGFS
FGGTCAMQMGTSHPDVYASILPFAAEREPALAKDRNKTISDSFDGDVEAF
ESRTPLVLMEQRNFAGSGVYLVSGEADREFTDYMHELADAARNAGFETEE
HAIPHAGHSWDAVIRGMPGGLDFLAARWGLPR
bifdb-d2q9l6: Bifidobacterium dentium (strains ATCC 27534 / DSM 20436 / JCM 1195 Bd1; ATCC 27678) Putative uncharacterized protein, 1 reference(s)Bifidobacterium dentium Show
MRQWLMNVSLLQGWLPATLFAITAALIVILLIGAIATIRKAGLKPVLMPL
VVAAVAGAVGFVITWLLSDVFMVFGVELGPHVFVWTSAGCATVGFAVTHM
AMRRRASRALAVILVIFALLASALGIDQAYGEYATLGSLFGVDSYHEADL
TGMADRRDLITIAQWRQGVADHTIRNVPSHGAVDKVDIPATTSGFKARKA
LVYLPPAALVPTKAKPALPVILMLSGQPGCPNRVFNAGGIQTMMDDYAQH
HQGLAPIVIAADQLGADSHNTLCVDSQVYGNALTYLTQDVVDWVKDNLPA
AQDAKDWAIAGFSQGATCSMQIGPNYPNLFGTIIPTGSEIGPSNGSEQEM
IDRFFDGDREAYERQIPINAIRNHAPSDQTLIMGTGEKDVESLRNIEEIA
PVARKAGMHVTAVESLGNAHDWHAVQDTLRYGLAVFGYDTGMSSVKPKLS
DYTNLRRIKIS
catad-c7q7s8: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR / 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MSLTSTALLILAVCSAVAAPAATYVLWNRARGPRPVRAAARLGLIGLCQA
TMLLLVGLLVNNHYSLYASWSDLLGQDGGGPVAVRQATDAATDLNHPVTS
STDSRGRFGFGGHGQGSHSTPPSTPRTGNAGNTAKPAWVSGNHGTLIAAF
RGPHSGIGGNSGDVHVWLPPQYHDPAYANTRFPVVMLFPGYPGSPTGWFS
VLNGGQILGQMAARQQATPFVLVAVNVNQHGENLNCSNIPGGPQMATYVA
EDVRTMIEANFRVSDQRTGWGLMGFSDGGLCAGKLLMQYPQYFRSAAQLA
GDSTPDGDQVVRAGAAFVERNSTLWLLKHHHPSANQPVSLLASVSDQDTD
SLPVAFQLQAAAPDIVSVSEHAHGAHNPAVWRSWLPEMYTWLSRHLDKAS
G
catad-c7qfj4: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MSPTGWPMTVTAILLAVAAPIGTYLLWNRIRGPRPVRAVARLSMIGVSQV
MAILLCGVVVNNYYGLYASWDDLLGQTGSPGVIIHQNAVAAGTPIAGTAV
NGGRAQGGRGQVVPRVRPAGPVQTFKKYGDDALAASFTGPKSRLGGDNNV
LVWLPPQYNDPAYANTDFPVVMLFPGYPGTPQTWFGQMDGQKELAALVQQ
HTSTPFVLVAVNISPIKGVNTDCTDIPGGPQVATYITDDVRTMVERTFRV
TTDRSGWGMMGYSEGGLCAGKLLVQYPQLFSAAVQMSGDVRPGGYVSKYG
PTFADQNSTLWVLQNHKPNPPVSLLAAASAEDAHGSVLSDALSLQHVAPD
VVDVLKKDHGSHNTAVWKQWLPQAYGWLSQHLDQVHPQA
catad-c7qh95: Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR 102108 / JCM 14897) Putative esterase, 1 reference(s)Catenulispora acidiphila Show
MAASARGHRRAPKRSRRSPLRAVALFVISTALVVGSGVAFGYATHHLGKH
QVTDDASVVAPPTGPLSDATDDPSATTNSAPGGKPSVPASPRPSLPKATG
PGKVTELKVASSDDDWPSRPVFVYRPAVPANVVLPVVYLLHGVPGEPDRI
MDAVKAVLDKAFTSGGEQPFIVAAPTGEGTAHNDTEWADAVDGKDMVETY
MIKDVIPAVEGKTPRPAGMRAIVGFSMGGYGAANLTLRHPDLFDQFASMA
GYFRVDDPDGMFGSDSKIEAANTPDDMVQKAAGKRVLLLEDQQDPDPLIQ
GEASEFAKRLDDCNCGVDLSWHLEPGGHTYDFVTDSFPKVITFLNQGFTA
PAGTTPSAAG
cora7-c3pft2: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans) Putative membrane protein, 1 reference(s)Corynebacterium aurimucosum Show
MNNFIQSVLGLPLTDPVNGGIYIAIVVISALLIAWRLRKRDFVSFLLAAV
IATVAFFVLKHWDVPFHLFVAGLVPIAALISLIHHAGRRVLMAVIAAFST
LAVAGLANMEYQSYPDIGSLDPTPVAQEMDYAQFKAMKSSDSAAIVHLDL
PGTNSGFTARQATAYIPPAYWTQPERKLPVLVLLHGNPGGPEQWFGSGEA
AETADAFQRANGGLSPIVLAVDATGSETANPICADTSAAKVMTYLTTDVP
TGIKSAFRVDENQQHWTVTGLSYGGTCSLQILTNHPEAYGQAVDISGEAE
PTIGNHAATVSKFYGGDESAYQAANPAHLLEVKKYPDNQAIFIAGNRDNN
AVNALSQLNDAARAAGMRTFYTTRPGGHSFEVWRPALREVFAWVARRGGL
ADLTDPFDGVQDADLQR
cordi-q6nhd8: Corynebacterium diphtheriae Putative membrane protein, 1 reference(s)Corynebacterium diphtheriae Show
MSRVLSISLTQPLMMWFFMGLCVVSLLMIVYAVWRPWRVKGVVITLVAIT
VGAFAAKIIVEKLWRPFPDSIPISIYFAVALTVIALFATMFIRRRILLFI
ALCLSLVGSAGVANLTYQLYPDLRSLVPVEVAREMSYSEFAHVSKAPTAQ
GREIGAKVTFSLVGEKSSFPARDAIAYIPPSYWTKQADSLPVLVLMAGSP
GSPSDWFESARVDTVADEYQRTHDGKSPIVISVDATATLGGDPLCVDGPE
FKVMTYLTQDVPTGIKNAFKVNSDQSQWTIGGLSYGGTCSFQVITNHPSA
YGHFLDFSGQDELVSGTHEQTLAKFFGGDQKRYDDSNPAAILKKYSDGNR
FGSISGVFVAGSQDAESQKGLKRLNDLAQHAGMHTQYLEVPGGHDFGTWR
EAIRATFALSAQYGGL
corjk-q4juz4: Corynebacterium jeikeium (strains K411; ATCC 43734) putative membrane protein, 1 reference(s)Corynebacterium jeikeium Show
MTEFVRNIPLTGTWPEVITWVLIFATLTALFCSLPTEPAGRRKRAMIWSI
GVTTILTCGGLVLLMWGTTTPWSELGFRLVAGAAALILAANLAGWCVGAS
IKKIWTILLVAVLAVGSAAVANQSYELFPDVGQVDPIKLRTFNSVDELPK
AQAIPLKEWRKAKHENMPAEGSILNVSAPKKKSGFQARDMRVYLPPAWFT
SPRPQLPVLVLLAGIPGDPDQWFDTGDATDVARKYQQAHGGVAPIIISAD
ATGGTWDNPVCTDSNKGKVQTFLTEDLPSWVQRHLSPNPDQRTWTIGGLS
YGGTCTFQVITNHPDTYGSFVNISGERTPDDGISHESTVRNFFGGSEEKF
KAHNPEDLLKRRTYPHTAGMFIAGRDDDQAVGDLKRLHQLAVKAKMDVSY
NEVAGGHNFRTWRSGLALAFPFIARRGGLGN
cork4-c4lh42: Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) Putative membrane protein, 1 reference(s)Corynebacterium kroppenstedtii Show
MAGPGKTWKPFGGGTAIGVYVAGWALIVLIGLAIGSYCARGQTRLVPWFK
RMRATGPRSSKPRASFSQRWASIRWKSVARVVGACAAFVCGTVACVNVVN
NSFALYPSVDSLVGKEPYTTAQYADVKGTSTSFTPPQGSTIAGAWNGVSP
RNKGVLVPFMIPSPVSHFQTTESRVYLPPAYFANPRPLLPVVVLMNGLPG
SPSQWFEIGNAGQTLHHFERVHHGLAPVVVAINTTGNDDEDLGCFDTKKA
KVQTYMDTDVPQQIKKYFQVSNDPTQWAIGGLSYGGTCALQAIVNNPEPY
RYFLDFSGDRTPGTMSAKGNADTYFGGNLNAYLRVNPEDILKRRKFTGIK
GVFVAGQSDKSSVRDLKYMNGLAQSAGIDSSSREVPGGHDFGTWRLALVL
TLPDVARATRLIG
fraaa-q0rhz6: Frankia alni (strain ACN14a) Putative integral membrane esterase, 1 reference(s)Frankia alni Show
MGSLVIIGKWFLLAFAGATLAAWVGCLRFARRGRRAVTAGMAGVAVVLTL
ATAADLVNAHYGYLPRVDDVIGVRSWPTASTHDAVTATPARTHPHGSVVD
LPVPGVRSGFGVQQALVYLPPQYFTEPHARFPVVYLLHGSPGVPVDWYRA
NRAAQTGAWLADDHRPVILVAPRLSHGWLDDSECVDRPGEHIETYVVDDV
IPTVDARLRALPDRADRVFAGMSAGGFCALNLGLRHRDLVGTIVDMSGMD
RPTHDGGMVGLFGHRLDLAQVVEANTPARYAATLAPDPPMRIWFDCGLGD
HEALGDTRAMASILGARPGFTVRLRLRPGAHDFGVWRPALRDGLAWALAP
ASGVPVGLPAARAALRPGTGVPAAA
frasn-a8lbd8: Frankia sp. (strain EAN1pec) Putative esterase, 1 reference(s)Frankia sp. Show
MGSALGSLVIVATWFLLVLGALSAICWAGCVWMTRRRRAMAVGLGFLAAL
LTLATAADTANAHYGYLPRAADVLGLTSWPTASVREVVGPAPRPHPDGAV
VHLPIAGVHSGFGTHSALVYVPPQYFTDPGARFPVVYLFHGSPGIPLDWY
RAGQAAKTGAALARAGRPAILVAPPLGHGWLDDSECVDRPGERIETYLVD
DVLPTVDNLLRAIPDRADRVFAGISAGGFCALNLGLRHRDLVGTIVDISG
LARPTHSGGMTGLFGNRPDLAAVTAANTPESYSATLPPNPPTRVWLSCGL
MDFGPLGDIRKMALALYGRPGFTTVLRPRPGGHDFGVWRPALRDGLRWAF
P
garv4-d2rbq6: Gardnerella vaginalis (strain 409-05) Putative uncharacterized protein, 1 reference(s)Gardnerella vaginalis Show
MLQLAKVSLLQGWLPVSLFSVNGISLVLLLFMKTKRGKKMFHLLIQLAIG
VITFFVGGIIAWLISDVFLVFEVSLGWLVIFSIACGFGLIGFAATAFVFL
HKWRKLVAVIAIILTLASTALHVDMIYGEYTTIGSIFGMGGFPKLEVNKQ
KSASSSIKQWRELAAQQKLPKLPKKGIVRSVYIPNTASHFNARIANVYLP
PAALVKKPPKLPVMVMFAGQPGSPNHFFAASDIANTLDNYAKNHYGLAPI
VVAPDQNGESSHNSLCADTHVFGKAETYLINDVPKWIRKHLPVSKDPKMW
LMGGFSQGGTCSTQLVPSHPDIFGNIFSAGGELEPTYKNRQETINHYFNG
NTSEYERHIPSVIMRKNAPLKQNYYAIAGSWDTKSQANQATIALSAHRAG
MNVITMLSQGNGHDWHTVKAGLKIAIDQFCKKTGISSTAPKLNTYQNVQI
LINQQVNRD
grafk-a0m243: Gramella forsetii (strain KT0803) Acetylesterase, 1 reference(s)Gramella forsetii Show
MSSLRTIELSDKNFETDGLRFLTVKTKNLKGRGDICLFVPEVAENVTNLP
IYILLHGVYGSAWVWALKGGAHHTAKQLMDNGSIDPAIIAMPSDGLWGDG
SSYLSHQEKDFAQWIVSDVPKAIIENIPSAGEKSKLCIGGLSMGGYGALM
LGAKYPQKFKAISAHSAITTFKGMAAFVEENLNLYNLKDVEKNVIDVILE
HQDQLPNLRFDCGRNDDLLKANRKLHRQLLELGVKHSFEEFEGGHEWSYW
QKHLELSLRFFDEQIGV
kocrd-b2gih2: Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 DC2201) Putative uncharacterized protein, 1 reference(s)Kocuria rhizophila Show
MAFFELTGWPVFFAFTAAAVLLLAYTVLVLPRRRRPGVGKYVLQLVCVVL
VVVLTLISVFLKMNMDNQWYSSWGDLFSNGGGAVSASSFGAAPAAAKALK
DLPHQPFSAAQTDPTRNKSFGSQVDPGSTSGQWVQFTLPGKESGITQEAT
AWLPPSYTQDPQRAYPVITAFTGFPGDVRTYTKAMDIGQHIRSAVSEGTM
REAIVVIADVYPGNNDTECVDSNHGLWETYVSRDVVSWIRSNLRVSDDRD
AWSTYGYSAGGWCSTMFTVRHPDVWSRSVNLAGYFTPMYSPGQQWKTRDP
ASYNLARVVEQEKPDVDIWFFSGGEDTISLKAIRAFAPSVSGPTGLSSNI
SESGGHRVALWAAQLDASLAWLGHTSPAFAPVPA
leixx-q6aed1: Leifsonia xyli (subsp. xyli) hypothetical protein, 1 reference(s)Leifsonia xyli Show
MTLRIDKPPFLIAVDVIALLLALYLLIRPSERRLFVGVAAAAGGGIVGAL
LVWLTDDVLDLFGVGLTPVTTMWTALGFAGVGLAIANLFRSRWWRKLIAV
VSVPVFLAAAAAGVNVDFGAYRNLNDALGVVPYGPLNLHAEYGEIVAGTD
WAGTTQQTEAPAKGEVGTVRIPATVSHFPARQAVVYLPPVALGPNPPALP
VLYALSGQPGAPADMFTAGRIASFMDAYAAEHNGYAPIVVAPDQLGGPGR
NPMCIDSHEFGNSATYILTDVRNWIASHLRVSSDPAAWGIFGYSEGATCA
VQFASGHPQLFGSALASSSELGPTLGVEALTIARGFGGSRSAYEKAQPAA
MMETHAPYENSTMVLGAGQDDAKYTAFAKTLHEDALRAGIHAELLISPGT
AHDWNTVRHTLAKGFPQIAGQLGLTGIGTARTGETG
micsp-Q93PA9: Microscilla sp. PRE1 ms122, putative esterase, 1 reference(s)Microscilla sp. PRE1 Show
MGKSKFRTTELSNPAFEMDGLRFITIKTPHLKGRGDICVFVPKGEDHQSL
PVVTLLHGVYGSAWVWPFLGNAHGITQRLIDQKKIPPMVLVMPSDGLWGD
GSGYMNHDGKNFEKWIAEDVPDAVFENIPEVSEESIHFIAGLSMGGFGAL
KIGAKYGEKYQAISAHSLITEVAQMTLFVEEPLDAYKQAERAREDVLTAI
IENRENLPRLRFDCGLDDELLDYNRTLHQELKKNQVPHTYEEFVGSHKWE
YWQEHLEDTLIFFKDVLKKSC
mycmm-b2hr10: Mycobacterium marinum (strain ATCC BAA-535 / M) Conserved hypothetical membrane protein, 1 reference(s)Mycobacterium marinum Show
MTTSPPALARVLASTHTSLMHGWVPVTVQVVTAIVLLLAIGWRSRRRLPA
AVIFGAIAAWATRWYLGTLANEPVPAALWVWVGLTAVAAAMLVVGWRGAR
WRRRTASLVAVPFCALCAALGLNIWVGYFPTVQAAWNQLSSGPLPDQADP
AAVVAMAGKGVRPAHGSMVPVAIPSNASHFKHRGELVYLPPAWFASYPPP
RLPAVMMIGGQFNTPADWARAGNAVRTIDDFALAHNGNAPVLVFVDSGGA
FNNDTECVNGRRGNAADHLTKDVVPYMISAFGVSPEPSNWGIVGWSMGGT
CAVDLTVMHPSLFSAFVDVAGDFYPNAGNKAETITRLFGGNADAWAAFDP
TTVINRHGQYTGISGWFSISVPAGPGAPRDVAITDPAVMRLAGREAAANP
SNQTAAANSLCALGRANGIDCAVVPQPGRHDWPFADQVFARALPWLAGQV
GTPGVPRIPLPGTASPATQVVPAGR
mycua-a0pp56: Mycobacterium ulcerans (strain Agy99) Conserved hypothetical membrane protein, 1 reference(s)Mycobacterium ulcerans Show
MFDNETVTTSPPALARVLASTHTSLMHGWVPDTVQVVTAIVLLLAIGWRS
RRRLPAAVIFGAIAAWVTRWYLGTLANEPVPAALWVWVGLTAVAAAMLVV
GWRGARWRRRTASLVAVPLCALCAALGLNIWVGYFPTVQAAWNQLSSGPL
PDQADPAAVVAMAGKGVRPAHGSMVPVAIPSNASHFKHRGELVYLPPAWF
ASYPPPRLPAVMMIGGQFNTPADWARAGNAVRTIDDFALAHNGNAPVLVF
VDSGGAFNNDTERVNGRRGNAADHLTKDVVPYMISAFDVSPEPSNWGIVG
WSMGGTCAVDLTVMHPSLFSAFVDVAGDFYPNAGNKAETITRLFGGNADA
WAAFDPTTVINRHGQYTGISGWFSISVPAGPGAPRDVAITDPAVMRLAGR
EAAANPSNQTAAANSLCALGRANGIDCAVVPQPGRHDWPFADQVFARALP
WLAGQLGTPGVPRIPLPGTASPATQEVPAGR
nocfa-q5yml0: Nocardia farcinica putative esterase, 1 reference(s)Nocardia farcinica Show
MIMQWSLVTGPLPWLLSGVGALCAAWLIGARRRLSAQAVAECAGLGFGAA
IVIWVVVERWWRPFPDALPRSVYTWVGIAVAALALLAVRISVTPRWIRRI
AAVTAAVCVITACAVQINLEFGAYPTLEDLLGTGSDNRISLTAVPAAQPN
PVTGWPIESVWSPPPPTQVDGRVVRAVIPGTRSGFRARPAEIYLPPAYFT
DPRPLLPVLVLLPGQPGSPVDWLNGGRVDQTMDAFAAAHGGLAPVTVIAD
ATGGAWRNPLCLDSRLGKVASYLAIDVPAWVNGRLQVDPDPRRWAIGGMS
YGGTCALQIATNYPDRYPSFLDLSGDAEPSLGDRRQTVQAAFGGDTAAFE
RVNPPTLLRTRRYPNSAGALVTGTEDDTTLSAQRSIAAAARAAGMTITTR
ELPGGHNWSVWSAGLRIEMDWLAQRLGLTR
proac-q6a7s1: Propionibacterium acnes Conserved membrane-associated protein, 1 reference(s)Propionibacterium acnes Show
MTDIAWFAPTGGVMMVSILSHKLCVAVLIAAFALPLAFVVWRAIAGTGSW
WRKILRGLGHLVVILLAQALLITGVFLYINREYGFFTSWSDLLGEVQPEA
PTHDLVPIRRTKVKDIPISKSNPHPNGQVSAITVPGADAQYARVPVWLPP
QYFEKSERRTRFPVLFYIGGVNDTGQRDNKSIDFIGPATELIKGRKVNPF
VIVFLPGKIRDGVDSECVDVGPYRHETWIMKIVIPRLESHYRVGHERGSR
FIGGWSTGGYCAANLSTKYPRAFNAGFSLGGYYHPMFENPRIANMARPLM
ANSSVVRRVQERKIERSVRFLSVLNPNDLQSWGPGRVPVVSNGQVGPDGG
QFYHVAKGMKQFTFILLTGGGHRVSVYTPYIEQSLQWLGQFGL
rensm-a9wup0: Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 1148/ NBRC 15589 / NCIMB 2235) Integral membrane protein, 1 reference(s)Renibacterium salmoninarum Show
MAGIGLTTGFLTILLPVLGVIGLAWLLIGPVKHLRLAVPSALVIGAVVGF
GAKFLIDDLINPWGAPLDWRIYLFVGIGVAALALLVPRMFGSKRWFIKII
APIALILVVVAVAGQINQVFGGYPTLGSIWGDNGVKIEVQSTPPPDQSLV
LTAQTPTVKLADWVPPADMPAKGKVVRVAIPGTVSGVISGDNYIYIPPAY
QVENPANVPVLVLIHGNPGGSIDWLQSGQLAQEMDAYAAANKGIAPLVVM
PDVSANYSSPNWPLCMDSNLSKGGTFLAVDVPNYVRSTYRLGLGSSQQFA
IGGFSFGGTCALQMGTVFPAHYHTFIDISGERAPFMTGGDAAIVKTYFGG
DAAAFAKVNPLDVLKSSKLSNSKALVIVGGNDGTYRPQNEEVFRALKTAG
VQASFQLLPGGHSWSVWKPGLMNNIDWLMQQYGVR
rhoe4-c0zp51: Rhodococcus erythropolis (strains PR4/NBRC100887; SK121) Conserved hypothetical membrane protein, 1 reference(s)Rhodococcus erythropolis Show
MDWLYRISLISGPLPVILTVLGVLGGVWLLGSSVRWYYRRAVPIAGLIAL
VIMIAVWITVEKVIVPFPDPIEMSIYVWIGIGIYAVLLLGPRIKAGGTIA
KAVVSVVATVLVIVTAATQINLVFAAYPTVGIAFGHDDFDRISLSEVPGP
TDPVVTGDPTDTVWKAPEGMPIRGRVTTLPVPGTISGFSARDAQVYLPPS
YFTNPRPLLPVLVLMAGQPGKPEDWLQGGKLTATMDAFARDHEGLAPVVV
IADGTGSQMANPLCTDSSQGKVGTYLAKDLPAAVANAFQIDTNPRAWAIG
GLSYGGTCSLQMATNYPDVYPTFLDLSGQLEPSLGDRQRTVDEIFGGDEA
AFVKVNPMDLLATRKFPNSGGVFVVGTDDNEFKPGQQKVYEAAKAAGMDA
RYLELPGGHSFSVWSAGVEQELTWISQRMGLIS
rhoe4-c0zyp1: Rhodococcus erythropolis (strains PR4/NBRC100887; SK121) Conserved hypothetical membrane protein, 1 reference(s)Rhodococcus erythropolis Show
MWILERMHGHQLLTRLSRMSLEHGHITAALLVGSVLVGVGALLLLRWLPR
RAVLVALGLSVVGSAGGAMLVWLSYRPLPAQLPLSSFVWIALAIFGVIGA
ALVLLRRPGLARGLSVTVLAGLAAIVAVGQVNAQTGTYPTLGSLVGHWPV
GSVEHVAFDSLPGAEPWLQRGLPTETHWEVPVRMPSNGVVTEASIPGNIS
GFDARPATLYLPPAYLADPRAELPVLVLVAGEPGSPSDWLDSGRLATTVD
AYASRHSGFAPVVVVPDALGDYDANPGCMDSALGNVATYLDQDVPNWIES
NLQVNPDAAQWAIGGFSYGGTCAIEMAVNFPDRYPSFLDFSGQDEPSTGD
HEDTVAAMFDGDEDAFDAVNARDLMAQNRYPQLSGVFVAGEDDDIYRPQQ
EIMFEAARAADMNVDYYTLPGGHSGDVWGTALELEMDWLGRTLALTP
rhoer-c3jwn8: Rhodococcus erythropolis (strains PR4/NBRC100887; SK121) Integral membrane protein, 1 reference(s)Rhodococcus erythropolis Show
MHTITDLSLVTGPVPPVVTVLGILALLWLIFSRSRRHVLISIPVCIVAAI
AITLVLYWLIEKVWHPFPDPIARPVYVWIGLGILGVLLGVSRVFAATRID
GRVLTVVSVLLVVVSSAAHVNLQFQSYPTLGTALGLSDAEKVSLADLDDG
KDGAVPVSQWKAPADMPSAGKVSTVTIAGTVSGFSARDAEIYLPPAYFTN
PRPELPVLVLLAGQPGAPEDWLQGGRLVQTMDTYAAAHSGLAPVVVVADG
TGSELANPLCVDSQLGNVATYLSRDVPDWVRGNLQVDPDPRKWAIGGLSY
GGTCAFQMATNFPAVYPTFLDLSGQIEPTLGDRKQTVDAAFGGNDAAFVA
VNPQDLLREKKFPDSAGVFVVGKQDNDYRPGLQTLYEAAKAAGMDVQYAE
VDGGHSFQVWSAGLASQLGWLGTRLGLPG
rhosr-q0ryn3: Rhodococcus sp. (strain RHA1) Possible esterase, 1 reference(s)Rhodococcus sp. Show
MLTDLSLLSGPVPFVVAATGAAGGVWLLTGRAGWLRRRAIPLCAAAAGVL
TGFLWFWVERVWRPLPDPIPLTVYLWTALALWAVTLLISRILTAPRRVWA
AAVSVVAAVAVVAACAVQINLFFAAYPTVGAAMGFEHVTRIDFQAVPPPV
PTPIAGRPLESVWTPPADMPHSGKITSVTIPGDRSRFSARRAEIYLPPAY
FSDPRPQLPVLVLLAGQPGQPRDWLTGGRLGTTMNNYARDHGGLGPVVVV
ADATGSTWGNPLCVDSPLGNAATYLAEDVPAWTKAHLQVDPDPGGWAIGG
LSLGGTCALQMATNYPQTYPTFLDLSGDPEPTLGDHQRTLDAAFGGNQAA
FTRVNPLDLLAEHHYPRSAGVFVVGSHDDELKPSIRKACDAARQAGMDVT
YTEVRGGHNFAVWAAALATEMDWLAARLGLTT
rhosr-q0s1n4: Rhodococcus sp. (strain RHA1) Possible esterase, 1 reference(s)Rhodococcus sp. Show
MNTGGVHAHELLSRIAHLSLEHGRAQIVSTVAVVAGVVVMLAASRSARAP
ILRAAAVAVPVTAVIGAAVWARYRPLPNQIPPAGYARIWLAVGTLVLAAT
ILLRKPGVRLAAAVGTAGAVVAAAAVGQVNAEVGVFPTVGSLVGHRAPTV
VEPVSFGDVPGFESAVQAGTPMDSVWTRPVRTPGSGVVTEVEIPGTESGF
PARPAVLYLPPAYLTSPRAVLPVMVMIAGQPGRPQDWFSSGRLGSTVDAY
AARHDGLAPVVVVVDALGAQDANPLCLDSALGNAATYVARDVPAWIENSL
QVSHDPAQWAIGGFSYGGTCSIQLAVNYPAIYPTFLDFLGQDEPSLGDHA
GTVAATFAGDERAFAAVNPVDVLRTRQFPELTGVFVAGAADDEYRPQQQR
MFAAARAAGLNVRYYELPGGHEGATWGAALEGEMDWTGRQLGLTG
rhosr-q0s6b3: Rhodococcus sp. (strain RHA1) Possible esterase, 1 reference(s)Rhodococcus sp. Show
MNVTPAILPVAPSRRRSAGSRSRLRDVEWLSDLSVISGPLPWILTVIGVL
GGVWLLAARTPWYRRKAIPICLAVSVVVTVVLYWMVEKVLRPFPDPIEIP
IYVWIGLGLFAIVLLVPRIRAGRTVKAAVVSVLAVLAVLLASATQINLVF
DAYPTVGTAFGAEPFDRVQMNDLGSTAENVVTGTPLDASWTAPPGMPSEG
RVLTAGIPGTASGFAARDAEIYLPPAYFANPRPLLPVLVMLAGQPGSPED
WFAGGKLATTMNEFAAKHGGLAPIVVVADGTGSQIANPLCVDSKLGNVAT
YLAKDVPSWVKSNLQVNPDPKAWAIGGLSYGGTCSLQMATNYPDVYPTFL
DISGQEEPTLGDHQRTLDDGFGGDEAAFKRVNPLDLMASKQYPDSAGVFV
IGSDDDAYKPGAQKVYQAAKNAGMDVQYVEVPGGHSFAVWSAGLEKELPW
LAQRLGLIGS
rhosr-q0sc04: Rhodococcus sp. (strain RHA1) Possible esterase, 1 reference(s)Rhodococcus sp. Show
MKPSQRTPLDRCRPGVIVTVAWMSGIRCGGSRTDRGSVHLHRRPGPHSRI
RILRNATGRRGTPATVPDVLTLLAEKRSGPVRSTPPSRTVGSKISGISDI
LQGHTLVDLSLLSGPIPLLVAATGAAGGVWLLTGHAGWFRRRAIPLCAAT
AAILTGCLWFWVERVWRPLPDPIPLTVYLWTALALWAVALLVPRVLIAPR
RAWAAAVSVVAAAAVVAACAVQVNLFFAAYPTVGAALGFEHVTRIDFRSV
PPPTPTPITGRPLESIWTPPADMPRSGAVTSVNIPGDRSGFHARRADIYL
PPAYFTDPRPQLPVLVLLAGQPGQPKDWLTGGRLGTTMDNFAHHHGGLGP
VVVVADATGSTWDNPLCVDSPLGHAATYLAEDVPTWTKAHLQVDPDPGGW
AIGGLSLGGTCALQMATNYPQTYPTFLDLSGDPEPTLGDHQRTLDAAFGG
NQAAFTRVNPLDLLAEHRYPDSAGVFVVGSHDDELKPSIRKACDAARQAG
MDVTYVEVRGGHTFAVWSVALATEMNWLATRLGLTPS
sanks-d1bgi7: Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 ST-74) Enterochelin esterase-like enzyme, 1 reference(s)Sanguibacter keddieii Show
MHTVSGSAAVAGMVSGGAAFGGGVAGSSASRSSASVHVVPTDLISSWWTV
VVLAVLAGGAVTFAVVRRVRHRRATRAAQGAGAPTAARPHARRPRSWHLV
LAGVGALLLAIGVGVNTWVGYLPTVDSLAIHLGLGPRLEVPPVRTGPVPG
ATVATVAADPADLPTGTGAFGSVRIDAPADLSVDPSDTWVYTPPGFDDSG
ETLYPVVVMIHGSPGGSADWFGAGLPAVLDSLITSGAVRPMIVVAPDMNG
RDQSEVTCVDSTRGGSQVETYLRDVVMPWVDDHYPVATGREYQAIGGMSA
GAYCALDQGLRHSADTGTILAIMPYGNPGDAQGAGLSTADEVAAHSPSDY
VDTVDLTDPTAVFLDYGTSEPDPEVPATAEDLAERLEARGQPVGLRTEPG
LGHSWTTATTALPYALEFFEQQMVAAETAR
strgg-b1vsh1: Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) Putative membrane protein, 1 reference(s)Streptomyces griseus subsp. griseus Show
MGLTSSAVLAVVAAVAVALFAATVGLWPRLARPGAAAVSGRVGLLLATQL
TLFAAVGLAANNAFLFYGSWADLFGRQQDLGVVTEHAGNGSASRHMTRIG
TQHPDVPGGRVPSVGGRIDKVVVSGRTSGIESPAYVYLPPEYFQGAYAGR
TFPAAVVLTGYPGTAENLLKGLRYPQTAHERVKAGKARPMILVMLRPTVA
PPRDTECVDVPGGPQTETFFAKDLPEAIGQSYRVGERARDWGIIGNSTGG
YCALKIGLHHPDRYAASVGLSAYYKAAEDPTTGDLFHGNGELRDRADLLW
TLENRPPSGGSFLVTTSRRGEDNLGSTMEFIGKVKAPARVSSIVLDSGGH
NFTTWRREIPPALEWLSARLGED
strsw-c9z0t6: Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative membrane protein, 1 reference(s)Streptomyces scabies Show
MGLTSNNVLFLAVLSAVLLFVGTVWLWPGLARRGWRAVGGRVAALLATQI
ALFACVGLVANQAFGFYASWADLLGRETGQGVVVDHDGAGTGGGPLRVVG
TRPVDVTGGERPQVGGQIQKVEIAGRTTRIATPAYVYLPPEYFQARYRTR
TFPAVVVLTGYPGTAEALVKGLHYPRTAHGLAREGAAQPMI</