Type : Peptide
Chemical_Nomenclature : MATSFQFDGLKPSFSASYSSKPIQTQVSNGMDNASAPV
Canonical SMILES :
InChI :
InChIKey :
Other name(s) :
MW :
Formula :
CAS_number :
PubChem :
UniChem :
IUPHAR :
Wikipedia :
Families : Presegetalin-F1 ligand of proteins in family: S9N_PPCE_Peptidase_S9
Stucture : 5O3U Structural characterization of the fast and promiscuous macrocyclase from plant - PCY1-S562A bound to Presegetalin F1
Protein : 9cary-r4p353
Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801 |
Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH |
Ref : ACS Chemical Biology , 13 :801 , 2018 |
Abstract : Ludewig_2018_ACS.Chem.Biol_13_801 |
ESTHER : Ludewig_2018_ACS.Chem.Biol_13_801 |
PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801 |
PubMedID: 29377663 |
Gene_locus related to this paper: 9cary-r4p353 |